DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp1 and POTEB3

DIOPT Version :9

Sequence 1:NP_524331.2 Gene:Arp1 / 41566 FlyBaseID:FBgn0011745 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_997238.2 Gene:POTEB3 / 102724631 HGNCID:51240 Length:581 Species:Homo sapiens


Alignment Length:432 Identity:71/432 - (16%)
Similarity:128/432 - (29%) Gaps:163/432 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GSGVIKAGFAGEH-------------------IPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKA 62
            |||....|.:|:|                   .|.||     |..|......|..:...|:.|:.
Human    74 GSGTSNVGTSGDHDNSFMKTLRSKMGKWCCHCFPCCR-----GSGKSNVGTWGDYDDSAFMEPRY 133

  Fly    63 EEHRGLLSIRYPMEHGIVTDWNDMERI-----WSYIYSKEQLATFTEDHPVLLTEAPLNPRRNRE 122
            ...|                 .|::::     |..:..|:.:        |:|.:..:| :|:::
Human   134 HVRR-----------------EDLDKLHRAAWWGKVPRKDLI--------VMLRDTDMN-KRDKQ 172

  Fly   123 KAAEFFFEGINAPALFVSM----------------------------QAVLSLYATGRVTGVVLD 159
            |.........|..:..|.:                            :.||.|...|....:..:
Human   173 KRTALHLASANGNSEVVQLLLDRRCQLNVLDNKKRTALIKAVQCQEDECVLMLLEHGADGNIQDE 237

  Fly   160 SGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVTRYLKTLIRREGFNFRSTAEFEIVRSIKEKVC-- 222
            .|:...|.....|...|..:::   :.|.|:                         ..|.| |  
Human   238 YGNTALHYAIYNEDKLMAKALL---LYGADI-------------------------ESKNK-CGL 273

  Fly   223 ---YLATNPQKEETVETEKFAYKLPDGKIFEIGPARFRAPEVLFRPDLLGEECEG----IHDVLM 280
               .|..:.||::.|   ||..|         ..|...|.:...|..|:...|.|    ::.:|.
Human   274 TPLLLGVHEQKQQVV---KFLIK---------KKANLNALDRYGRTALILAVCCGSASIVNLLLE 326

  Fly   281 YSIEKSDMDLRKMLYQNIVLSGGSTLFKGFGDRLLSELKKHSAKDLKIRIAAPQERLYSTWMGGS 345
            .:::.|..||.....:...:|....:.    ..|||:.|:.....:....:.|::.|.       
Human   327 QNVDVSSQDLSGQTAREYAVSSHHHVI----CELLSDYKEKQMLKISSENSNPEQDLK------- 380

  Fly   346 ILASLDTFKKMWISK------------------REYEEEGQK 369
             |.|.:..:::.:|:                  ||.|||.:|
Human   381 -LTSEEESQRLKVSENSQPEKMSQEPEINKDCDREVEEEIKK 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp1NP_524331.2 NBD_sugar-kinase_HSP70_actin 5..376 CDD:302596 71/432 (16%)
ACTIN 9..376 CDD:214592 71/432 (16%)
POTEB3NP_997238.2 Ank_4 143..193 CDD:290365 9/58 (16%)
ANK 167..292 CDD:238125 24/157 (15%)
ANK 1. /evidence=ECO:0000255 172..201 3/28 (11%)
ANK repeat 174..203 CDD:293786 2/28 (7%)
Ank_2 177..269 CDD:289560 12/119 (10%)
ANK repeat 205..236 CDD:293786 4/30 (13%)
ANK 2. /evidence=ECO:0000255 205..234 4/28 (14%)
ANK 233..357 CDD:238125 27/168 (16%)
ANK repeat 238..269 CDD:293786 6/58 (10%)
ANK 3. /evidence=ECO:0000255 238..267 6/56 (11%)
Ank_2 243..335 CDD:289560 23/132 (17%)
ANK repeat 271..302 CDD:293786 10/42 (24%)
ANK 4. /evidence=ECO:0000255 271..300 9/40 (23%)
ANK repeat 304..335 CDD:293786 6/30 (20%)
ANK 5. /evidence=ECO:0000255 304..333 5/28 (18%)
ANK 6. /evidence=ECO:0000255 337..366 5/32 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 369..494 11/61 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.