DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp1 and POTEB

DIOPT Version :9

Sequence 1:NP_524331.2 Gene:Arp1 / 41566 FlyBaseID:FBgn0011745 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001264233.1 Gene:POTEB / 100996331 HGNCID:33734 Length:544 Species:Homo sapiens


Alignment Length:432 Identity:72/432 - (16%)
Similarity:128/432 - (29%) Gaps:163/432 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GSGVIKAGFAGEH-------------------IPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKA 62
            |||....|.:|:|                   .|.||     |..|......|..:...|:.|:.
Human    37 GSGTSNVGTSGDHDDSFMKTLRSKMGKWCCHCFPCCR-----GSGKSNVGTWGDYDDSAFMEPRY 96

  Fly    63 EEHRGLLSIRYPMEHGIVTDWNDMERI-----WSYIYSKEQLATFTEDHPVLLTEAPLNPRRNRE 122
            ...|                 .|::::     |..:..|:.:        |:|.:..:| :|:::
Human    97 HVRR-----------------EDLDKLHRAAWWGKVPRKDLI--------VMLRDTDMN-KRDKQ 135

  Fly   123 KAAEFFFEGINAPALFVSM----------------------------QAVLSLYATGRVTGVVLD 159
            |.........|..:..|.:                            :.||.|...|....:..:
Human   136 KRTALHLASANGNSEVVQLLLDRRCQLNVLDNKKRTALIKAVQCQEDECVLMLLEHGADGNIQDE 200

  Fly   160 SGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVTRYLKTLIRREGFNFRSTAEFEIVRSIKEKVC-- 222
            .|:...|.....|...|..:::   :.|.|:                         ..|.| |  
Human   201 YGNTALHYAIYNEDKLMAKALL---LYGADI-------------------------ESKNK-CGL 236

  Fly   223 ---YLATNPQKEETVETEKFAYKLPDGKIFEIGPARFRAPEVLFRPDLLGEECEG----IHDVLM 280
               .|..:.||:|.|   ||..|         ..|...|.:...|..|:...|.|    ::.:|.
Human   237 TPLLLGVHEQKQEVV---KFLIK---------KKANLNALDRYGRTALILAVCCGSASIVNLLLE 289

  Fly   281 YSIEKSDMDLRKMLYQNIVLSGGSTLFKGFGDRLLSELKKHSAKDLKIRIAAPQERLYSTWMGGS 345
            .:::.|..||.....:...:|....:.    ..|||:.|:.....:....:.|::.|.       
Human   290 QNVDVSSQDLSGQTAREYAVSSHHHVI----CELLSDYKEKQMLKISSENSNPEQDLK------- 343

  Fly   346 ILASLDTFKKMWISK------------------REYEEEGQK 369
             |.|.:..:::.:|:                  ||.|||.:|
Human   344 -LTSEEESQRLKVSENSQPEKMSQEPEINKDCDREVEEEIKK 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp1NP_524331.2 NBD_sugar-kinase_HSP70_actin 5..376 CDD:302596 72/432 (17%)
ACTIN 9..376 CDD:214592 72/432 (17%)
POTEBNP_001264233.1 ANK 130..255 CDD:238125 25/157 (16%)
ANK 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU00023 135..167 3/31 (10%)
ANK repeat 137..166 CDD:293786 2/28 (7%)
ANK 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU00023 168..200 4/31 (13%)
ANK repeat 168..199 CDD:293786 4/30 (13%)
ANK 196..320 CDD:238125 28/168 (17%)
ANK 3. /evidence=ECO:0000255|PROSITE-ProRule:PRU00023 201..233 7/59 (12%)
ANK repeat 201..232 CDD:293786 6/58 (10%)
ANK 4. /evidence=ECO:0000255|PROSITE-ProRule:PRU00023 234..266 11/43 (26%)
ANK repeat 234..265 CDD:293786 11/42 (26%)
ANK 5. /evidence=ECO:0000255|PROSITE-ProRule:PRU00023 267..299 6/31 (19%)
ANK repeat 267..298 CDD:293786 6/30 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 332..457 11/61 (18%)
SMC_N <412..>542 CDD:330553
CCDC144C 489..>542 CDD:317340
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.