DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp1 and ACTR3

DIOPT Version :9

Sequence 1:NP_524331.2 Gene:Arp1 / 41566 FlyBaseID:FBgn0011745 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_005712.1 Gene:ACTR3 / 10096 HGNCID:170 Length:418 Species:Homo sapiens


Alignment Length:406 Identity:136/406 - (33%)
Similarity:207/406 - (50%) Gaps:61/406 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VIDNGSGVIKAGFAGEHIPKCRFPNYI--------GRPKHVRVMAGALEGDIFVGPKAEEHRGLL 69
            |:|.|:|..|.|:||...|:...|:.|        |.....|||.|..:.|.|:|.:|.| :...
Human     9 VVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIE-KPTY 72

  Fly    70 SIRYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNREKAAEFFFEGINA 134
            :.::|:.||||.||:.|||....:..| .|....|||..||||.|||...|||..||..||..|.
Human    73 ATKWPIRHGIVEDWDLMERFMEQVIFK-YLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNV 136

  Fly   135 PALFVSMQAVLSLYA--TGR------VTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVT 191
            |.|::::||||:|.|  |.|      :||.|:||||||||.:|:.||:.:...|..:.|||||:|
Human   137 PGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDIT 201

  Fly   192 RYLKTLIRREGFNFRSTAEFEIVRSIKEKVCYLATNPQKE------------------ETVETEK 238
            .:::.|:|............|..:::||:..|:..:..||                  ..:..::
Human   202 YFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKE 266

  Fly   239 FAYKLPDGKIFEIGPARFRAPEVLFRPDLLGEE-CEGIHDVLMYSIEKSDMDLRKMLYQNIVLSG 302
            |:        .::|..||..||:.|.|:....: .:.|.:|:...|:...:|:|:.||:||||||
Human   267 FS--------IDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSG 323

  Fly   303 GSTLFKGFGDRLLSELKKH----------------SAKDLKIRIAAPQERLYSTWMGGSILASLD 351
            |||:|:.||.||..:||:.                ..|.:.:::.....:.|:.|.|||:|||..
Human   324 GSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTP 388

  Fly   352 TFKKMWISKREYEEEG 367
            .|.::..:|::|||.|
Human   389 EFYQVCHTKKDYEEIG 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp1NP_524331.2 NBD_sugar-kinase_HSP70_actin 5..376 CDD:302596 136/406 (33%)
ACTIN 9..376 CDD:214592 136/406 (33%)
ACTR3NP_005712.1 PTZ00280 2..417 CDD:240343 136/406 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.