DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp1 and Actl10

DIOPT Version :9

Sequence 1:NP_524331.2 Gene:Arp1 / 41566 FlyBaseID:FBgn0011745 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_003749645.1 Gene:Actl10 / 100911682 RGDID:6491130 Length:334 Species:Rattus norvegicus


Alignment Length:326 Identity:102/326 - (31%)
Similarity:177/326 - (54%) Gaps:21/326 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 EHRGLLSIRYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNREKAAEFF 128
            |..|.::..:|::||:|.||:.:|.:|..: ....|....|..|||::::|..|...|||.||..
  Rat    16 ELAGGVARAHPIKHGVVVDWDALEGLWERL-MVGGLQIHPEQWPVLVSDSPSAPPEGREKVAELL 79

  Fly   129 FEGINAPALFVSMQAVLSLYATGRVTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVTRY 193
            ||.:..||..::..|:|:|.:.|..:|:.:::|.||.||.|||.|.:...:..|:::||..::||
  Rat    80 FEALTVPACHMASTALLALCSVGAFSGLAVEAGAGVCHATPIYAGHSWHKATFRLNVAGSTLSRY 144

  Fly   194 LKTLIRREGFNFRSTAEFEI-------VRSIKEKVCYLATNPQKE--ETVETEKFAYKLPDGKIF 249
            .:.|:      ..|..:.::       |..:|::.||::.:.|.:  :....::..:.|..|...
  Rat   145 FRDLL------VASCPDLQLHALPRKTVTQLKKRCCYVSLDFQGDICDPARHQRACFCLGKGCYV 203

  Fly   250 EIGPARFRAPEVLFRPDLLGEECEGIHDVLMYSIEKSDMDLRKMLYQNIVLSGGSTLFKGFGDRL 314
            .:|..|||.||.:|:|.|||....|:..:...:::|....||..|...:||:||||||.||.:|:
  Rat   204 RLGSERFRCPEPIFQPSLLGHPEPGLPTLAFQALQKIPTTLRTRLANTVVLAGGSTLFPGFVERM 268

  Fly   315 LSEL----KKHSAKDLKIRIAAPQERLYSTWMGGSILASLDTFKKMWISKREYEEEGQKAVHRKT 375
            ..||    ::|....|:..:.|...|..:.|.|||::|||.:|::.|:::..|:|.|...| |:.
  Rat   269 NLELQAQCRRHGYPALQPCLVAHPGRGTAVWTGGSMMASLHSFQRRWMTRAMYQEYGPFLV-REV 332

  Fly   376 F 376
            |
  Rat   333 F 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp1NP_524331.2 NBD_sugar-kinase_HSP70_actin 5..376 CDD:302596 101/324 (31%)
ACTIN 9..376 CDD:214592 101/324 (31%)
Actl10XP_003749645.1 NBD_sugar-kinase_HSP70_actin 25..329 CDD:302596 97/310 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.