DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a4 and CYP72C1

DIOPT Version :9

Sequence 1:NP_650224.3 Gene:Cyp313a4 / 41563 FlyBaseID:FBgn0038076 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:300 Identity:79/300 - (26%)
Similarity:120/300 - (40%) Gaps:66/300 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLFLLWIY----FLWSRRRFYLLTLKIPGPLG--YPIL-----------GMAHW--LMRREDILN 55
            :|.|.|::    ::|.|.:.....||..|..|  |.||           .:||.  |....|.|.
plant    17 ILILNWVWRAVNWVWLRPKRLEKYLKKQGFSGNSYRILMGDMRESNQMDQVAHSLPLPLDADFLP 81

  Fly    56 AFGCFLD----KHGPTIFSWLGPIPFMIVSDPQVVQDI------FTSPHCVNKGIIYKAVDDGAG 110
            ....||.    |||...|:|.||.|.:||.||:.:::|      |..|...:...::.:      
plant    82 RMMPFLHHTVLKHGKKCFTWYGPYPNVIVMDPETLREIMSKHELFPKPKIGSHNHVFLS------ 140

  Fly   111 VGLFSLKDPRWSIHRKLLNPAFGHKVLLSFLPIFNRETALLLDQLEPL---QDDGEKDLIPLLQS 172
             ||.:.:.|:||.||.:|||||....|.|.||.||.....:|::.|.|   :...|.|.......
plant   141 -GLLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSSCKEMLEEWERLASAKGTMELDSWTHCHD 204

  Fly   173 FTLGIATQTTMGSDVKD--------EESFRSNSLLGRYQCILETMTDMCFSPWLNSRFCRQLAGK 229
            .|..:..:.:.|...||        :|......|..|...|..       |.:|.::|.|:|.  
plant   205 LTRNMLARASFGDSYKDGIKIFEIQQEQIDLGLLAIRAVYIPG-------SKFLPTKFNRRLR-- 260

  Fly   230 ESHYYQAKTEIRQFIRKIIERKLAEDEMGALPSIQSNDKN 269
                 :.:.::|...:.:||.|..|.:.|     :..|||
plant   261 -----ETERDMRAMFKAMIETKEEEIKRG-----RGTDKN 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a4NP_650224.3 p450 33..465 CDD:299894 71/272 (26%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 169 1.000 Domainoid score I1170
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.