DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a4 and CYP4F3

DIOPT Version :9

Sequence 1:NP_650224.3 Gene:Cyp313a4 / 41563 FlyBaseID:FBgn0038076 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens


Alignment Length:504 Identity:131/504 - (25%)
Similarity:220/504 - (43%) Gaps:78/504 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLTWTLWCGLLFLLWIYFLWS---RRRFYLLTLKIPGP------LGYPILGMAH----WLMRRED 52
            :|....|.....|.|.|..:.   |.|.:      |.|      ||:  ||:.|    .|:..:.
Human    23 LLVGASWLLARILAWTYTFYDNCCRLRCF------PQPPKRNWFLGH--LGLIHSSEEGLLYTQS 79

  Fly    53 ILNAFG---CFLDKHGPTIFSWLGPIPFMI-VSDPQVVQDIFTSPHCV--NKGIIYKAVDDGAGV 111
            :...||   |:          |:||...:: :..|..::.:..:|..:  ...:.|..:....|.
Human    80 LACTFGDMCCW----------WVGPWHAIVRIFHPTYIKPVLFAPAAIVPKDKVFYSFLKPWLGD 134

  Fly   112 GLFSLKDPRWSIHRKLLNPAFGHKVLLSFLPIFNRETALLLDQLEPLQDDGEK--DLIPLLQSFT 174
            ||......:||.||::|.|||...:|..::.|||....::..:.:.|..:|..  |:...:...|
Human   135 GLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSARLDMFEHISLMT 199

  Fly   175 LGIATQTTMGSDVKDEES--------FRSNSLL-GRYQCILETMTDMCFSPWLNSRFCRQLAGKE 230
            |....:.....|...:|.        ...::|: .|:|.||           |...|...|....
Human   200 LDSLQKCVFSFDSHCQEKPSEYIAAILELSALVTKRHQQIL-----------LYIDFLYYLTPDG 253

  Fly   231 SHYYQAKTEIRQFIRKII-ERKLAEDEMGALPSIQSNDKNLFLNLVTDLMRRGVFTLKNVED--- 291
            ..:.:|...:..|...:| ||:......|....:|:..|:..|:.:      .|..|...||   
Human   254 QRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFI------DVLLLSKDEDGKK 312

  Fly   292 --------ESNIIVFGAFETTANAVYYTLMLLAMFPEYQERAFEEIKTIFPNTGDFDVSYADTQQ 348
                    |::..:|...:|||:.:.:.|..||..||||||..:|::.:..:....::.:.|..|
Human   313 LSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEWDDLAQ 377

  Fly   349 MVYLDLILNESMRVIPPVPVVSRQTSQDLKLSNGIVVPKGVQIAIDIYHMHRSKKIWGPDAETFN 413
            :.:|.:.:.||:|:.||||.|||..:||:.|.:|.|:|||:...|.::..|.:..:| ||.|.::
Human   378 LPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDGRVIPKGIICLISVFGTHHNPAVW-PDPEVYD 441

  Fly   414 PDHFLPHNIQDKHPYAYIPFTKGIRNCIGWRYALISAKVTLAKLLRNYR 462
            |..|.|.||:::.|.|:|||:.|.|||||..:|:...||.|...|..:|
Human   442 PFRFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLRFR 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a4NP_650224.3 p450 33..465 CDD:299894 124/469 (26%)
CYP4F3NP_000887.2 p450 52..515 CDD:365848 124/469 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.