DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a4 and Cyp12d1-d

DIOPT Version :9

Sequence 1:NP_650224.3 Gene:Cyp313a4 / 41563 FlyBaseID:FBgn0038076 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_995812.1 Gene:Cyp12d1-d / 2768720 FlyBaseID:FBgn0053503 Length:521 Species:Drosophila melanogaster


Alignment Length:405 Identity:95/405 - (23%)
Similarity:177/405 - (43%) Gaps:61/405 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 GLFSLKDPRWSIHRKLLNPAF----GHKVLLSFLPIFNRETALLLDQLEPLQD-------DGEKD 165
            ||.:.::..|...|..:||.|    |.::....|...|.|   .:::::.::|       :...|
  Fly   139 GLVASQNEAWGKLRSAINPIFMQPRGLRMYYEPLSNINNE---FIERIKEIRDPKTLEVPEDFTD 200

  Fly   166 LIPLLQSFTLG-IATQTTMGSDVKDEESFRSNSLLGRYQCI--LETMTDMCFSPWLNSRFCRQLA 227
            .|..|...:|| :|....||...|:.::..:.:|....:.|  |....|:..|.|       ::.
  Fly   201 EISRLVFESLGLVAFDRQMGLIRKNRDNSDALTLFQTSRDIFRLTFKLDIQPSMW-------KII 258

  Fly   228 GKESHYYQAKTEIRQFIRKIIERKLAEDEMGALPS-IQSNDK---NLFLNLVTDLMRRGVFTLKN 288
            ...: |.:.|..:...:.  :.:|:.::...||.. .|:.:|   |..|..:.::..: |..:.:
  Fly   259 STPT-YRKMKRTLNDSLN--VSQKMLKENQDALEKRRQAGEKINSNSMLERLMEIDPK-VAVIMS 319

  Fly   289 VEDESNIIVFGAFETTANAVYYTLMLLAMFPEYQERAFEEIKTIFPNTGDFDVSYADTQQMVYLD 353
            ::     |:|...:.||..:...|:.|:..|:.|.:..||:.:|.| |.|..::..:.:.|.||.
  Fly   320 LD-----ILFAGVDATATLLSAVLLCLSKHPDKQAKLREELLSIMP-TKDSLLNEENMKDMPYLR 378

  Fly   354 LILNESMRVIPPVPVVSRQTSQDLKLSNGIVVPKGVQIAIDIYHMHRSKKIWGPDAETF-NPDHF 417
            .::.|::|..|......|....|:.|| |..||||..:.:       ...:...:|..: .||.|
  Fly   379 AVIKETLRYYPNGFGTMRTCQNDVILS-GYRVPKGTTVLL-------GSNVLMKEATYYPRPDEF 435

  Fly   418 LPHN-IQDKH--------PYAYIPFTKGIRNCIGWRYALISAKVTLAKLLRNYRFK----TSFPF 469
            ||.. ::|..        |:.::||..|.|.|||.|...:..:.|:|||:||:..:    .|.||
  Fly   436 LPERWLRDPETGKKMQVSPFTFLPFGFGPRMCIGKRVVDLEMETTVAKLIRNFHVEFNRDASRPF 500

  Fly   470 ENLYFVED-ITMKLK 483
            :.::.:|. ||...|
  Fly   501 KTMFLMEPAITFPFK 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a4NP_650224.3 p450 33..465 CDD:299894 88/384 (23%)
Cyp12d1-dNP_995812.1 p450 70..508 CDD:299894 91/396 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442770
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24305
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.