DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14395 and R148.5

DIOPT Version :9

Sequence 1:NP_001163598.1 Gene:CG14395 / 41560 FlyBaseID:FBgn0038073 Length:1073 Species:Drosophila melanogaster
Sequence 2:NP_001370569.1 Gene:R148.5 / 175422 WormBaseID:WBGene00020104 Length:528 Species:Caenorhabditis elegans


Alignment Length:284 Identity:66/284 - (23%)
Similarity:106/284 - (37%) Gaps:90/284 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 SLPLKDKVTSLQGLQEPLRQLY-LSEVTKKKLNSGSLDICATGLRVKISALAISNGAAAPEENEA 236
            |:|...| ..|||:|:||::.| :.|....:.....|.:.:.|:.::.        ....::.|.
 Worm    16 SVPTITK-DGLQGIQQPLKERYPIQESPDTRGIDSWLSVWSNGVLLEY--------IEGEKKTET 71

  Fly   237 LITPFHNIAVWSAVKFV----ISDDDGGAAFLPLITDPENIDKTALFQPLSSSEQLAVEHSIHVH 297
            :..|...:...:||::|    .....||..|:||.:...||..:.                   |
 Worm    72 VFFPIITLHYCAAVRYVNVEGFKVGGGGEQFMPLDSPFANIPNSP-------------------H 117

  Fly   298 APIFAVVMRSASSPKVLECHGFICKSTEDAIVIAATL---YQSLMAHVSSSSR---------RST 350
            .||||.:.|..:..||||||||||.:.:.|..:...:   |...| |:....|         .||
 Worm   118 PPIFAAIFRRTTGVKVLECHGFICTNVKAANALVRCMVHAYTETM-HLRMDERIPGLKAIKEGST 181

  Fly   351 QRRAP-----------------------------RQQNGVSCISIASSSALASSNYLSRSQ---- 382
            ..|:|                             |||:| ...|::.||:|.:.|..:.|:    
 Worm   182 GDRSPNSPSSEIEENSFEEDVVPEEKNMKNWQERRQQDG-EYDSVSISSSLVNKNKKAASEQGGI 245

  Fly   383 ---IVP-------SASGRRSSFRG 396
               :||       :.|....|:||
 Worm   246 RGALVPFDEPLRRAGSDNDLSYRG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14395NP_001163598.1 PH-like 183..322 CDD:302622 37/143 (26%)
R148.5NP_001370569.1 PTB_CG12581 1..166 CDD:241252 45/178 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158543
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21219
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.