DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dtg and CHS5

DIOPT Version :9

Sequence 1:NP_650220.2 Gene:Dtg / 41558 FlyBaseID:FBgn0038071 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_013434.1 Gene:CHS5 / 851041 SGDID:S000004322 Length:671 Species:Saccharomyces cerevisiae


Alignment Length:364 Identity:91/364 - (25%)
Similarity:151/364 - (41%) Gaps:87/364 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PIE-----STSLPAEVDDVEGTTILP-IQLEESSPTPEPIIKNETA--TALPVVE---LKVAESN 94
            |:|     ||:|..|. .:|  |:.| ::..:|.|...|.|:...|  :|..|||   ..||||:
Yeast   339 PVEDPLHASTALENET-TIE--TVNPSVRSLKSEPVGTPNIEENKADSSAEAVVEEPNEAVAESS 400

  Fly    95 PVDPV-----EATDNFVSVYGGN----LEQDIKNDVNSEVEDAPSPVEPIIEEVQKVA--EAELE 148
            |.:..     |.||...:....|    .|:..:|::.:  |.|....||..:...:..  |||:|
Yeast   401 PNEEATGQKSEDTDTHSNEQADNGFVQTEEVAENNITT--ESAGENNEPADDAAMEFGRPEAEIE 463

  Fly   149 NHEIKLAVQSAREPKSLDAEEESKTIDEDRLENQDKAETVTDN---IAVSSEQMESHIRPLPNVT 210
            ..|:..:::.|.||    ||:.::.:::.....:|..:.|.|:   :..|::.:|...:|:.:. 
Yeast   464 TPEVNESIEDANEP----AEDSNEPVEDSNKPVKDSNKPVEDSNKPVEDSNKPVEDSNKPVEDA- 523

  Fly   211 SDLVSVILNEDKAITEQPITKTNLLALEQEHEKFEEIDESTTVPVYEEPKHQVTKKQGVEDPSTV 275
                    ||....|.:|:        |...|..:|.:|.||  ....|:||      .||....
Yeast   524 --------NEPVEDTSEPV--------EDAGEPVQETNEFTT--DIASPRHQ------EEDIELE 564

  Fly   276 EIPPEVSDEQHFDPSEEPQTVRDERNLEEHDDNQNEINENIIEGEEAPAKTSTTAGPLVTVEPTK 340
            ..|.:.::....:||.|  .|:.|....|.:|:.|.:::....||      |||           
Yeast   565 AEPKDATESVAVEPSNE--DVKPEEKGSEAEDDINNVSKEAASGE------STT----------- 610

  Fly   341 SITEPNEEIEKKAEAEAKAEMEEQ----VEVNTPSVDAT 375
                 :::.|..|..|:.|..|||    .||||..|.:|
Yeast   611 -----HQKTEASASLESSAVTEEQETTEAEVNTDDVLST 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DtgNP_650220.2 PTZ00341 <112..325 CDD:173534 49/221 (22%)
rne <303..445 CDD:236766 21/77 (27%)
DUF3295 <410..>498 CDD:288540
CHS5NP_013434.1 Chs5_N 4..76 CDD:260117
fn3_2 77..165 CDD:407129
BRCT_CHS5_like 172..255 CDD:349373
MDN1 <366..607 CDD:227596 64/273 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.