DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dtg and RP1

DIOPT Version :9

Sequence 1:NP_650220.2 Gene:Dtg / 41558 FlyBaseID:FBgn0038071 Length:612 Species:Drosophila melanogaster
Sequence 2:XP_016869210.1 Gene:RP1 / 6101 HGNCID:10263 Length:2163 Species:Homo sapiens


Alignment Length:513 Identity:99/513 - (19%)
Similarity:189/513 - (36%) Gaps:137/513 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LLASCSAQPIESTSLPAEVDDVEGTTILPIQLEESSP-TPEPIIKNETATALPVVELKVAESNPV 96
            |.|:||...|:|....:|.:..:|.:.|......|.. .||..:...|.:...:..:..|.| |.
Human  1215 LSANCSTVNIQSVPKCSENERTQGISSLDGGCSASEACAPEVCVLEVTCSPCEMCTVNKAYS-PK 1278

  Fly    97 DPVEATDNFVSVYGGNLEQDIKNDVNSEVEDAPSPVEPIIEEVQKVAEAELENH---------EI 152
            :....:|.|....|..::|...|.. ..:.:..|..:.:..:   .|.|:.|||         |.
Human  1279 ETCNPSDTFFPSDGYGVDQTSMNKA-CFLGEVCSLTDTVFSD---KACAQKENHTYEGACPIDET 1339

  Fly   153 KLAVQSAREPKSLDAEEESKTIDEDRLENQDKAETVTDNIAVSSE--------QMESHIRPLPNV 209
            .:.|........|:::|.:.|.:.|..|..::.:.:..::.:.::        .:.|| :.:.|:
Human  1340 YVPVNVCNTIDFLNSKENTYTDNLDSTEELERGDDIQKDLNILTDPEYKNGFNTLVSH-QNVSNL 1403

  Fly   210 TSDLVSVILNEDKAITEQPITKTNLLALEQEHEKFEEIDESTTVPVYEEPKHQVTKKQGVEDPST 274
            :|  ..:.|:|.:|            .|:::|...::.:..:.....:|..:   ....:|:|.|
Human  1404 SS--CGLCLSEKEA------------ELDKKHSSLDDFENCSLRKFQDENAY---TSFDMEEPRT 1451

  Fly   275 VEIPPEVSDEQHFDPSEEPQTVRDERNLEEHDDNQNEINENIIEGEEAPAKTSTTAGPLVTVEPT 339
            .|.|..:::..    :...:.:.:..:.||.:::..:|...::.|.|               :.|
Human  1452 SEEPGSITNSM----TSSERNISELESFEELENHDTDIFNTVVNGGE---------------QAT 1497

  Fly   340 KSITEPNEEIEKKAE---AEAKAEMEEQ------VEV------NTPSVDATVVAADPDEAQDEVI 389
            :.:.:...|..|..|   ..:|..|||:      .|:      ..||:|....:....|.:    
Human  1498 EELIQEEVEASKTLELIDISSKNIMEEKRMNGIIYEIISKRLATPPSLDFCYDSKQNSEKE---- 1558

  Fly   390 VAETTVEAITEAAKIVVEEEPKEDVSVQQEHLKEQRVQTVSESNRQASPTEEPIKEVIFPKGDDE 454
                |.|..|:..|::|               |.....:.|||    ||   .:|:.|      :
Human  1559 ----TNEGETKMVKMMV---------------KTMETGSYSES----SP---DLKKCI------K 1591

  Fly   455 SPVEGDSSESDEKPTERAIVDDDSSEEQNEDVVDEGKSSSDDSTATPLVSYPPHDAGQ 512
            |||..|  .||.:|        ||..||      ..|:||||          |:|:|:
Human  1592 SPVTSD--WSDYRP--------DSDSEQ------PYKTSSDD----------PNDSGE 1623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DtgNP_650220.2 PTZ00341 <112..325 CDD:173534 35/229 (15%)
rne <303..445 CDD:236766 29/156 (19%)
DUF3295 <410..>498 CDD:288540 24/87 (28%)
RP1XP_016869210.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.