DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dtg and IBSP

DIOPT Version :9

Sequence 1:NP_650220.2 Gene:Dtg / 41558 FlyBaseID:FBgn0038071 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_004958.2 Gene:IBSP / 3381 HGNCID:5341 Length:317 Species:Homo sapiens


Alignment Length:318 Identity:67/318 - (21%)
Similarity:104/318 - (32%) Gaps:101/318 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 KFEEIDESTTV---PVYEEPKHQV----TKKQGVEDPSTVEIPPEVSDEQHFDPSEEPQTVRDER 300
            |.|:.:|:...   |.|...||..    .|:..|:..|      :.|:|...|.|||.:.     
Human    27 KIEDSEENGVFKYRPRYYLYKHAYFYPHLKRFPVQGSS------DSSEENGDDSSEEEEE----- 80

  Fly   301 NLEEHDDNQNEINENIIEGEEAPAKTSTTAGPLVTVEPTKSITEPNEEIEKKAEAEAKAEMEEQV 365
              ||...|:.|.||                             |.||:.:.:||           
Human    81 --EEETSNEGENNE-----------------------------ESNEDEDSEAE----------- 103

  Fly   366 EVNTPSVDATVVAADPDEAQDEVIVAETTVEAITEAAKIVVEEEPKEDVSVQQEHLKEQRVQTVS 430
              || ::.||.:....|         .|.....|..|.|   :.||:...:..:..||:......
Human   104 --NT-TLSATTLGYGED---------ATPGTGYTGLAAI---QLPKKAGDITNKATKEKESDEEE 153

  Fly   431 ESNRQASPTEEPIKEVIFPKGDDESPVEGDSSESDEKPTERAIVDDDSSEEQNEDVVD------- 488
            |...:.:..||...||    .::|..:.|.|:.|.|..........|:.||..|:.|.       
Human   154 EEEEEGNENEESEAEV----DENEQGINGTSTNSTEAENGNGSSGGDNGEEGEEESVTGANAEDT 214

  Fly   489 -----EGKSSSDDSTATPLVSYPPHDAGQTFDSNSAD---------EHSAQLSGATNY 532
                 :||.:| .:|.:|...:.|....|.:.:.|..         |...:.:||..|
Human   215 TETGRQGKGTS-KTTTSPNGGFEPTTPPQVYRTTSPPFGKTTTVEYEGEYEYTGANEY 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DtgNP_650220.2 PTZ00341 <112..325 CDD:173534 22/88 (25%)
rne <303..445 CDD:236766 27/141 (19%)
DUF3295 <410..>498 CDD:288540 22/99 (22%)
IBSPNP_004958.2 BSP_II 17..314 CDD:283165 67/318 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..254 55/268 (21%)
cell-attachment tripeptide 286..288
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.