DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dtg and Muc18B

DIOPT Version :9

Sequence 1:NP_650220.2 Gene:Dtg / 41558 FlyBaseID:FBgn0038071 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001285431.1 Gene:Muc18B / 32913 FlyBaseID:FBgn0031000 Length:308 Species:Drosophila melanogaster


Alignment Length:215 Identity:47/215 - (21%)
Similarity:77/215 - (35%) Gaps:51/215 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 RDERNLEEHDDNQNEINENIIE--GEEAPAKTS--TTAGPLVTVEPTKSITEPNEEIEKKAEAEA 357
            ||:.|:|......:.::|:..|  ..|||..|.  |||.|..|.:.|.......|:|..:|....
  Fly    81 RDDSNIENPTIPPSNLDESTTEKPATEAPGTTEKVTTAAPGTTEKVTTEAPGTTEKITTEAPGTT 145

  Fly   358 KAEMEEQVEVNTPSVDATVVAADPDEAQDEVIVAETTVEAITEAAKIVVEEEPKEDVSVQQEHLK 422
                 |::....|.....:....|.          ||.:..|||..  ..|:|..|.        
  Fly   146 -----EKITTEAPGTTEKITTEAPG----------TTEKITTEAPG--TTEKPATDA-------- 185

  Fly   423 EQRVQTVSESNRQASPTEEPIKEVIFPKGDDES-----PVEGDSSESDEKPTERAIVDDDSSEEQ 482
                         ...||:|..:.  |...::|     |...|.|::|...|:.....:.|::|.
  Fly   186 -------------PGTTEKPATDA--PGTTEKSETTDAPGTTDKSDTDAPITDEPSTAETSTDEP 235

  Fly   483 NEDVVDEGKSSS--DDSTAT 500
            |.:..:.|:.::  |:..||
  Fly   236 NTETTESGEETTIEDNVCAT 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DtgNP_650220.2 PTZ00341 <112..325 CDD:173534 9/29 (31%)
rne <303..445 CDD:236766 30/145 (21%)
DUF3295 <410..>498 CDD:288540 17/94 (18%)
Muc18BNP_001285431.1 CBM_14 26..72 CDD:279884
MCLC <77..177 CDD:283562 27/112 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.