Sequence 1: | NP_650220.2 | Gene: | Dtg / 41558 | FlyBaseID: | FBgn0038071 | Length: | 612 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_036719.2 | Gene: | Ibsp / 24477 | RGDID: | 2855 | Length: | 319 | Species: | Rattus norvegicus |
Alignment Length: | 257 | Identity: | 60/257 - (23%) |
---|---|---|---|
Similarity: | 96/257 - (37%) | Gaps: | 62/257 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 267 QGVEDPSTVEIPPEVSDEQHFDPSEEPQTVRDERNLEEHDDNQNEINENIIEGEEAPAKTSTTAG 331
Fly 332 PLVT--VEPT---------------------------KSITEPNEEIEKKAEAEAKAEMEEQVE- 366
Fly 367 VNTPSVDATVV-------AADPDEAQDEVIVAETTVEAITEAAKIVVEEEPKEDV---SVQQEHL 421
Fly 422 KEQRVQTVSESNRQASPTE--EPIKEVIFPKGDDESPVEGDSSESDEKP---TERAIVDDDS 478 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dtg | NP_650220.2 | PTZ00341 | <112..325 | CDD:173534 | 16/57 (28%) |
rne | <303..445 | CDD:236766 | 41/183 (22%) | ||
DUF3295 | <410..>498 | CDD:288540 | 17/77 (22%) | ||
Ibsp | NP_036719.2 | BSP_II | 17..316 | CDD:283165 | 60/257 (23%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 59..116 | 19/67 (28%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 135..224 | 21/88 (24%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 237..263 | 7/25 (28%) | |||
Cell attachment site | 288..290 | 0/1 (0%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1181 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |