DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dtg and Ibsp

DIOPT Version :9

Sequence 1:NP_650220.2 Gene:Dtg / 41558 FlyBaseID:FBgn0038071 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_036719.2 Gene:Ibsp / 24477 RGDID:2855 Length:319 Species:Rattus norvegicus


Alignment Length:257 Identity:60/257 - (23%)
Similarity:96/257 - (37%) Gaps:62/257 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 QGVEDPSTVEIPPEVSDEQHFDPSEEPQTVRDERNLEEHDDNQNEINENIIEGEEAPAKTSTTAG 331
            ||..|.|......:.|:|:    .||.:|..:|.|.|:.:.|         |.:||.|:.:|.:|
  Rat    61 QGGSDSSEENGDGDSSEEE----GEEEETSNEEENNEDSEGN---------EDQEAEAENATLSG 112

  Fly   332 PLVT--VEPT---------------------------KSITEPNEEIEKKAEAEAKAEMEEQVE- 366
            ...:  ||.|                           |...|..||.|::.....:||::|..: 
  Rat   113 VTASYGVETTADAGKLELAALQLPKKAGDAEGKAPKMKESDEEEEEEEEEENENEEAEVDENEQV 177

  Fly   367 VNTPSVDATVV-------AADPDEAQDEVIVAETTVEAITEAAKIVVEEEPKEDV---SVQQEHL 421
            ||..|.::|.|       ..|..|..:|..|.|...|..|..|:.:........|   ..||...
  Rat   178 VNGTSTNSTEVDGGNGPSGGDNGEEAEEASVTEAGAEGTTAGARELTSYGTTTAVLLNGFQQTTP 242

  Fly   422 KEQRVQTVSESNRQASPTE--EPIKEVIFPKGDDESPVEGDSSESDEKP---TERAIVDDDS 478
            ..:...|.|...|::|..|  |..:::    |::.:.......|::.:|   |.||..|:.|
  Rat   243 PPEAYGTTSPPARKSSTVEYGEEYEQI----GNEYNTAYETYDENNGEPRGDTYRAYEDEYS 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DtgNP_650220.2 PTZ00341 <112..325 CDD:173534 16/57 (28%)
rne <303..445 CDD:236766 41/183 (22%)
DUF3295 <410..>498 CDD:288540 17/77 (22%)
IbspNP_036719.2 BSP_II 17..316 CDD:283165 60/257 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..116 19/67 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 135..224 21/88 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 237..263 7/25 (28%)
Cell attachment site 288..290 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.