Sequence 1: | NP_650220.2 | Gene: | Dtg / 41558 | FlyBaseID: | FBgn0038071 | Length: | 612 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_032344.2 | Gene: | Ibsp / 15891 | MGIID: | 96389 | Length: | 324 | Species: | Mus musculus |
Alignment Length: | 264 | Identity: | 61/264 - (23%) |
---|---|---|---|
Similarity: | 101/264 - (38%) | Gaps: | 75/264 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 267 QGVEDPSTVEIPPEVSDEQHFDPSEEPQTVRDERNLEEHDDNQNEINENIIEGEEAPAKTST--- 328
Fly 329 -----------TAGPLVTVE------PTKS---------ITEPNEEIEKKAEAE----AKAEMEE 363
Fly 364 -QVEVNTPSVDATVV--------AADPDEAQ-DEVIVAETTVEAITEAAKIVVEEEPKEDVSVQQ 418
Fly 419 EHLKEQRVQTVSESNRQASPTEEPIKEVIFPKGDDESPVE--GDSSES-DEKPTERAIVDDDSSE 480
Fly 481 EQNE 484 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dtg | NP_650220.2 | PTZ00341 | <112..325 | CDD:173534 | 16/57 (28%) |
rne | <303..445 | CDD:236766 | 42/184 (23%) | ||
DUF3295 | <410..>498 | CDD:288540 | 16/78 (21%) | ||
Ibsp | NP_032344.2 | BSP_II | 17..321 | CDD:283165 | 61/264 (23%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 60..228 | 45/179 (25%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 243..263 | 5/28 (18%) | |||
Cell attachment site. /evidence=ECO:0000255 | 293..295 | 0/1 (0%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1181 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |