DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dtg and Ibsp

DIOPT Version :9

Sequence 1:NP_650220.2 Gene:Dtg / 41558 FlyBaseID:FBgn0038071 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_032344.2 Gene:Ibsp / 15891 MGIID:96389 Length:324 Species:Mus musculus


Alignment Length:264 Identity:61/264 - (23%)
Similarity:101/264 - (38%) Gaps:75/264 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 QGVEDPSTVEIPPEVSDEQHFDPSEEPQTVRDERNLEEHDDNQNEINENIIEGEEAPAKTST--- 328
            ||..|.|......:.|:|:    .||.:|..:|.|.|:.:.|         |.:||.|:.||   
Mouse    61 QGGSDSSEENGDGDSSEEE----GEEEETSNEEENNEDSEGN---------EDQEAEAENSTLST 112

  Fly   329 -----------TAGPLVTVE------PTKS---------ITEPNEEIEKKAEAE----AKAEMEE 363
                       |.....|.|      |.|:         :.|.:||.|::.|.|    .:||::|
Mouse   113 LSGVTASYGAETTPQAQTFELAALQLPKKAGDAESRAPKVKESDEEEEEEEEEEENENEEAEVDE 177

  Fly   364 -QVEVNTPSVDATVV--------AADPDEAQ-DEVIVAETTVEAITEAAKIVVEEEPKEDVSVQQ 418
             ::.||..|.::|.|        ..:.:||: :|..|.|...|..|...::.       .|..|.
Mouse   178 NELAVNGTSTNSTEVDGGNGSSGGDNGEEAEAEEASVTEAGAEGTTGGRELT-------SVGTQT 235

  Fly   419 EHLKEQRVQTVSESNRQASPTEEPIKEVIFPKGDDESPVE--GDSSES-DEKPTERAIVDDDSSE 480
            ..|.....||........: |..||::        .|.||  |:..:: :|...|..:.|:::.|
Mouse   236 AVLLNGFQQTTPPPEAYGT-TSPPIRK--------SSTVEYGGEYEQTGNEYNNEYEVYDNENGE 291

  Fly   481 EQNE 484
            .:.:
Mouse   292 PRGD 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DtgNP_650220.2 PTZ00341 <112..325 CDD:173534 16/57 (28%)
rne <303..445 CDD:236766 42/184 (23%)
DUF3295 <410..>498 CDD:288540 16/78 (21%)
IbspNP_032344.2 BSP_II 17..321 CDD:283165 61/264 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 60..228 45/179 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..263 5/28 (18%)
Cell attachment site. /evidence=ECO:0000255 293..295 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.