DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dtg and MUCL3

DIOPT Version :9

Sequence 1:NP_650220.2 Gene:Dtg / 41558 FlyBaseID:FBgn0038071 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_543146.2 Gene:MUCL3 / 135656 HGNCID:21666 Length:1393 Species:Homo sapiens


Alignment Length:659 Identity:143/659 - (21%)
Similarity:227/659 - (34%) Gaps:186/659 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SCSAQPIE-----------STSLPAEVDD------VEGTTILPIQ---------LEESSPTP-EP 73
            |.||:|.|           :||.|||..:      .|.||..|.:         .|:::|.| ||
Human   796 SSSAEPTEHAERTPLANENTTSSPAEPTENRERTANEKTTQFPAEPTENRESTANEKTTPFPAEP 860

  Fly    74 I-----IKNETATALPVVELKVAESNP-------VDPVEATDNFVSVYGGNLEQDIKNDVNSEVE 126
            .     ..||..|..|....:..|..|       :.|.|.|:|      |.     :....:| :
Human   861 TENREWTANENTTLSPAEPTEHEEMTPLANEKTTLSPAEPTEN------GE-----RTPFTNE-K 913

  Fly   127 DAPSPVE--------PIIEEVQKVAEAELENHEIKLAVQSAREPKSLDAEEESKTIDEDRLENQD 183
            ..||..|        |:..|:...:.||...|..::|.:.|....:...|....|::||...:  
Human   914 TTPSSAEPTEHGERTPLANEITTPSRAEPTEHGERIANEKATPSPAKPTEHGETTVNEDTTPS-- 976

  Fly   184 KAETVTDNIAVSSEQMESHIR-PLPNVTSDLVSVILNEDKAITEQPITKTNLLALEQEHEKFEEI 247
                       |:|..|:..| ||.|..:             |..|...|       ||.: ...
Human   977 -----------SAEPTENGERTPLANENT-------------TTSPTEST-------EHGE-RTA 1009

  Fly   248 DESTTVPVYEEPKHQVTKKQGVEDPS----TVEIPPEVSDEQHFDPSEEPQTVRDERNLEEHDDN 308
            :|.||....|..:|      |...||    |:..|.:.::.:...||....|........||.:.
Human  1010 NEKTTPSPAEPTEH------GERTPSANEKTIPSPAKPTEHEEMTPSANENTTPSPVKPTEHGEK 1068

  Fly   309 QNEINENIIEGEEAP----AKTSTTAGPLVT---VEPT---KSITEPNEEIEKKAEAEAKAEMEE 363
            ....||.|....|.|    ||| |:|...:|   .:||   :..|.||::|...|     ||..|
Human  1069 TTLANEKITLSPEGPTEHGAKT-TSANEKITPSLAKPTEHGERTTSPNDKITSSA-----AESTE 1127

  Fly   364 QVEVNTPSVDATVVAADPDEAQDEVIVAETTVEAITEAAKIVVEEEPKEDVSVQQEHLKEQRVQT 428
            ..:..|.:...|...|:|.:......:|...:..:||.:    .|.|::..|..::..:.....|
Human  1128 HRDRATSANVITPAPAEPIKHAKRTTLAHEKMTQVTEKS----TEHPEKTTSTTEKTTRTPEKPT 1188

  Fly   429 V-------------------SESNRQASPTEEPIKEVIFPKGDDESPVEGDSSESDEKPTERAIV 474
            :                   :|:....:.|.|.||.   |....|:|.:..:.....||:.:...
Human  1189 LYSEKTICTKGKNTPVPEKPTENLGNTTLTTETIKA---PVKSTENPEKTAAVTKTIKPSVKVTG 1250

  Fly   475 DDD---SSEEQNED-------------VVDEGKSSSDDSTATPLVSYPPHDAGQTFDSNSADEHS 523
            |..   :|...|:.             :....|.||..|.||...|:|..:.    |.:....|:
Human  1251 DKSLTTTSSHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNESHPYLNK----DGSQKGIHA 1311

  Fly   524 AQLSGATNYRSTLIIALCSGTAVIFIVASLVIFVVSF-QRQHGTL-------DIE---------- 570
            .|:....::.:..|:.:.....::.:|...:||:||: .|...||       |.|          
Human  1312 GQMGENDSFPAWAIVIVVLVAVILLLVFLGLIFLVSYMMRTRRTLTQNTQYNDAEDEGGPNSYPV 1376

  Fly   571 --MQEQRLG 577
              |::|.||
Human  1377 YLMEQQNLG 1385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DtgNP_650220.2 PTZ00341 <112..325 CDD:173534 47/229 (21%)
rne <303..445 CDD:236766 38/170 (22%)
DUF3295 <410..>498 CDD:288540 19/122 (16%)
MUCL3NP_543146.2 Atrophin-1 <299..820 CDD:331285 7/23 (30%)
LGT <916..1062 CDD:320995 39/185 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.