DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6753 and AT1G15060

DIOPT Version :9

Sequence 1:NP_650219.2 Gene:CG6753 / 41557 FlyBaseID:FBgn0038070 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001319006.1 Gene:AT1G15060 / 838071 AraportID:AT1G15060 Length:578 Species:Arabidopsis thaliana


Alignment Length:290 Identity:62/290 - (21%)
Similarity:106/290 - (36%) Gaps:68/290 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 WDFSWHEMGVYDLPAQVDYVLRTTGQK--AMHFVGISQGGTVFLVLNSMM---------PQYNAV 191
            |||. |.: ..|:||.::||...:..|  .:..:|.|.||   ::|.:|:         |...||
plant   329 WDFD-HYL-EEDVPAAIEYVRAQSKPKDGKLFAIGHSMGG---ILLYAMLSRCAFEGREPSVAAV 388

  Fly   192 FKSATLLAPVAYVSNTKSGLAKVIGPVLGTRNYVS-------KMLEGVEMFSTNKFFKKFLSMTC 249
               |||.:.|.|  .|.:...|::.|:......:|       .:|......||            
plant   389 ---ATLASSVDY--TTSNSALKLLIPLANPAEALSVPVVPLGALLAAAFPLST------------ 436

  Fly   250 LENEKPLVCISRLWPAVGYDTRFLNKTLLPDLMAN----FPAGGSVKQLMHYFQGYVSTRFRQYD 310
                :|...:|.|...:. .|..::..:|..|:.|    .||    |.|:.     ::|.||:..
plant   437 ----RPPYVLSWLNDLIS-STDMMHPEMLEKLVLNNFCTIPA----KLLIQ-----LTTAFREGG 487

  Fly   311 YGPERNWLHYQQLEPPEYALENVSTPVTVFFSENDYIVAPADIWRLLTRLPNVEAVYKV----PW 371
            ........:|:.      .|...|.||.....:.|.|..||.:...:...|.....||:    ..
plant   488 LRDRSGKFYYKD------HLPRTSVPVLALAGDRDLICPPAAVEDTVKLFPENLVTYKLLGEPDG 546

  Fly   372 KRWNHFDFICGLGVREYIFDNIVLSMNRYE 401
            ..:.|:|.:.|....|.::..|...::.::
plant   547 PHYAHYDLVGGRLAVEQVYPCITEFLSHHD 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6753NP_650219.2 PLN02872 39..394 CDD:215470 61/281 (22%)
AT1G15060NP_001319006.1 Hydrolase_4 <330..545 CDD:403389 56/256 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.