DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6753 and CG17097

DIOPT Version :9

Sequence 1:NP_650219.2 Gene:CG6753 / 41557 FlyBaseID:FBgn0038070 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_609429.1 Gene:CG17097 / 34461 FlyBaseID:FBgn0265264 Length:1087 Species:Drosophila melanogaster


Alignment Length:357 Identity:127/357 - (35%)
Similarity:199/357 - (55%) Gaps:9/357 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IQNDGYNVERHSVTTKDGYVLTLHRIPQVDPELGSLLRRPVVFLLSGLYASSDVWLLNGREDSLA 103
            |:..||..|.:.||::|||.|.|||||:...|       ||: |:.||.|||..|:..|.:|.||
  Fly   730 IEKYGYPSETNYVTSEDGYRLCLHRIPRPGAE-------PVL-LVHGLMASSASWVELGPKDGLA 786

  Fly   104 YLLWRAGYDVWLGNNRGNIYCRKNMWRNTTEREFWDFSWHEMGVYDLPAQVDYVLRTTGQKAMHF 168
            |:|:|.|||||:.|.|||||.|:|:.|.....::||||:||:|.:|:||.:|::|..|.:..:.:
  Fly   787 YILYRKGYDVWMLNTRGNIYSRENLNRRLKPNKYWDFSFHEIGKFDVPAAIDHILIHTHKPKIQY 851

  Fly   169 VGISQGGTVFLVLNSMMPQYNAVFKSATLLAPVAYVSNTKSGLAKVIGPVLGTRNYVSKMLEGVE 233
            :|.|||.|||.|:.|..|.|.........|:|..|:...:|.:.|.:|...|..:.:..:|.|.|
  Fly   852 IGHSQGSTVFFVMCSERPNYAHKVNLMQALSPTVYLQENRSPVLKFLGMFKGKYSMLLNLLGGYE 916

  Fly   234 MFSTNKFFKKFLSMTCLENE-KPLVCISRLWPAVGYDTRFLNKTLLPDLMANFPAGGSVKQLMHY 297
            :.:..|..::|....|..:| ...:|....:...|:|.:..|.||.|.:.|:...|.|.||:.||
  Fly   917 ISAKTKLIQQFRQHICSGSELGSSICAIFDFVLCGFDWKSFNTTLTPIVAAHASQGASAKQIYHY 981

  Fly   298 FQGYVSTRFRQYDYGPERNWLHYQQLEPPEYALENVSTPVTVFFSENDYIVAPADIWRLLTRLPN 362
            .|......|:::|:|...|.:.|:..|||.|.|...::.|.:...|.|::.:.:|:.||..||||
  Fly   982 AQLQGDLNFQRFDHGAVLNRVRYESSEPPAYNLSQTTSKVVLHHGEGDWLGSTSDVIRLQERLPN 1046

  Fly   363 VEAVYKVPWKRWNHFDFICGLGVREYIFDNIV 394
            :....||.::.::||||.....||..::.:::
  Fly  1047 LVESRKVNFEGFSHFDFTLSKDVRPLLYSHVL 1078

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6753NP_650219.2 PLN02872 39..394 CDD:215470 127/355 (36%)
CG17097NP_609429.1 Abhydro_lipase 726..780 CDD:282003 25/57 (44%)
MhpC 746..1061 CDD:223669 115/322 (36%)
Abhydrolase_5 762..>899 CDD:289465 59/137 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439451
Domainoid 1 1.000 150 1.000 Domainoid score I1414
eggNOG 1 0.900 - - E2759_KOG2624
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D39202at50557
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - otm46497
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.