DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6753 and CG18301

DIOPT Version :9

Sequence 1:NP_650219.2 Gene:CG6753 / 41557 FlyBaseID:FBgn0038070 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_609419.1 Gene:CG18301 / 34451 FlyBaseID:FBgn0032265 Length:422 Species:Drosophila melanogaster


Alignment Length:371 Identity:133/371 - (35%)
Similarity:214/371 - (57%) Gaps:19/371 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IITDA----VRRIQNDGYNVERHSVTTKDGYVLTLHRIPQVDPELGSLLRRPVVFLLSGLYASSD 91
            ::.||    ::.|...||..|.::|.:.|||:|.|.||.:.    |:|   ||: |:.||..|||
  Fly    38 VLEDAHLNTIQLISKYGYPAENYTVQSDDGYLLGLFRIARP----GAL---PVL-LVHGLMDSSD 94

  Fly    92 VWLLNGREDSLAYLLWRAGYDVWLGNNRGNIYCRKNMWRNTTEREFWDFSWHEMGVYDLPAQVDY 156
            .|::.|...||.|:|:..|||||:.|.|||.|.::::..:..:.:||:||:||||::||||.:||
  Fly    95 TWVMMGPSSSLGYMLYEQGYDVWMANVRGNTYTKRHVRYSAEDSDFWNFSFHEMGIFDLPAIIDY 159

  Fly   157 VLRTTGQKAMHFVGISQGGTVFLVLNSMMPQYNAVFKSATLLAPVAYVSNTKSGLAKVIGPVLGT 221
            :|..:|...:|::|.|||.|:|.:|.|..|:|.........|||||::|:.:|.:..::.   ..
  Fly   160 ILMQSGFGQLHYIGHSQGSTIFWILASERPEYMEKIVMMQALAPVAFLSHCRSPIVNLLA---SQ 221

  Fly   222 RNYVSKMLEGV---EMFSTNKFFKKFLSMTCLENEKPLVCISRLWPAVGYDTRFLNKTLLPDLMA 283
            ...|:..|...   |...:|....:|....|.:.....||.|..:...|::.:.:|:|:||.::.
  Fly   222 DTAVASFLSAAGYNEFLPSNSVIDQFKRYACRDIISSSVCQSLFFILFGFNGQQVNQTMLPIVVG 286

  Fly   284 NFPAGGSVKQLMHYFQGYVSTRFRQYDYGPERNWLHYQQLEPPEYALENVSTPVTVFFSENDYIV 348
            :.|||.|::|:.||.|...|.:|:|:||| ..|:|||..|.||.|.||.|...|.:::::||:|.
  Fly   287 HTPAGASIRQMHHYGQLRNSGKFQQFDYG-LLNFLHYGSLSPPPYELEKVKAKVAIYYAKNDWIA 350

  Fly   349 APADIWRLLTRLPNVEAVYKVPWKRWNHFDFICGLGVREYIFDNIV 394
            .|.|:..|..|||||...|.||.:.:||||.:.|...:..:::.::
  Fly   351 PPEDVDMLFNRLPNVVEKYLVPNENFNHFDLVWGRDAKRILWNRML 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6753NP_650219.2 PLN02872 39..394 CDD:215470 131/357 (37%)
CG18301NP_609419.1 Abhydro_lipase 46..100 CDD:282003 23/61 (38%)
PLN02872 48..407 CDD:215470 131/361 (36%)
Abhydrolase_5 82..225 CDD:289465 58/146 (40%)
Abhydrolase_5 <327..379 CDD:289465 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439454
Domainoid 1 1.000 108 1.000 Domainoid score I1418
eggNOG 1 0.900 - - E2759_KOG2624
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 194 1.000 Inparanoid score I1354
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D39202at50557
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - mtm1092
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
109.900

Return to query results.
Submit another query.