DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6753 and CG2772

DIOPT Version :9

Sequence 1:NP_650219.2 Gene:CG6753 / 41557 FlyBaseID:FBgn0038070 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_608776.1 Gene:CG2772 / 33559 FlyBaseID:FBgn0031533 Length:416 Species:Drosophila melanogaster


Alignment Length:383 Identity:158/383 - (41%)
Similarity:213/383 - (55%) Gaps:21/383 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 AVRRIQNDGYNVERHSVTTKDGYVLTLHRIPQVDPELG-------SLLRRPVVFLLSGLYASSDV 92
            :..||...||..|.|.|.|.|||||.:.|||. .|:|.       |...||||.::.||::.||.
  Fly    35 SAERIAEHGYPAESHFVETPDGYVLNVFRIPH-SPKLNSNGNEGESEASRPVVLIMHGLFSCSDC 98

  Fly    93 WLLNGREDSLAYLLWRAGYDVWLGNNRGNIYCRKNMWRNTTEREFWDFSWHEMGVYDLPAQVDYV 157
            :||||.||:|.|....|||||||||.|||||.|.|...|.....||.|||||:|..||||.:||:
  Fly    99 FLLNGPEDALPYNYADAGYDVWLGNARGNIYSRNNTRLNVKHPYFWKFSWHEIGSIDLPATIDYI 163

  Fly   158 LRTTGQKAMHFVGISQGGTVFLVLNSMMPQYNAVFKSATLLAPVAYVSNTKSGLAKVIGPVLGTR 222
            |..|||:::|:||.|||.|.|.|:.|..|:|||..|:|.:|||..|:.|:..||.....|:.|..
  Fly   164 LAETGQQSLHYVGHSQGCTSFFVMGSYRPEYNAKIKTAHMLAPPVYMGNSTEGLIVSTAPLFGHH 228

  Fly   223 NYVSKMLEGVEMFSTNKFFKKFLSMTCLENEKPLV---C--ISRLW--PAVGYDTRFLNKTLLPD 280
            ...|.:||...:...|.|.::.|..||  :.:|::   |  ::.||  |.:|.    ||:||||.
  Fly   229 GIGSTLLENQVLLPQNAFIQRVLDTTC--SNQPIMLSYCKTLAILWGGPEIGN----LNQTLLPQ 287

  Fly   281 LMANFPAGGSVKQLMHYFQGYVSTRFRQYDYGPERNWLHYQQLEPPEYALENVSTPVTVFFSEND 345
            :....|||.|..|.:||.|.|.|..||.||:|.:||..:|...|||.|.|..:::.:.:::...|
  Fly   288 IAETHPAGVSSNQAIHYIQSYASNDFRLYDWGSKRNLEYYGVSEPPAYDLTKITSELYLYYGLAD 352

  Fly   346 YIVAPADIWRLLTRLPNVEAVYKVPWKRWNHFDFICGLGVREYIFDNIVLSMNRYEQR 403
            ......||.||...|||:..:::||...|.|.|||....|:..|.|.::.....|:.|
  Fly   353 GSANKQDISRLPDLLPNLALLHEVPDSTWGHLDFIFATEVKRVINDLVLDYSKAYDAR 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6753NP_650219.2 PLN02872 39..394 CDD:215470 155/368 (42%)
CG2772NP_608776.1 PLN02872 5..393 CDD:215470 153/364 (42%)
Abhydro_lipase 36..103 CDD:282003 29/67 (43%)
Abhydrolase 113..>196 CDD:304388 47/82 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471680
Domainoid 1 1.000 150 1.000 Domainoid score I1414
eggNOG 1 0.900 - - E2759_KOG2624
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 194 1.000 Inparanoid score I1354
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D39202at50557
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - mtm1092
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
109.900

Return to query results.
Submit another query.