DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6753 and LIPJ

DIOPT Version :9

Sequence 1:NP_650219.2 Gene:CG6753 / 41557 FlyBaseID:FBgn0038070 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001010939.2 Gene:LIPJ / 142910 HGNCID:21773 Length:366 Species:Homo sapiens


Alignment Length:367 Identity:126/367 - (34%)
Similarity:198/367 - (53%) Gaps:33/367 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GYNVERHSVTTKDGYVLTLHRIP--QVDPELGSLLRRPVVFLLSGLYASSDVWLLNGREDSLAYL 105
            ||..|.:.:.|:|||:|.|:|||  :.|.. .:|.:|.||:|..||..|:..|:.|...:||.::
Human    11 GYPDEEYDIVTEDGYILGLYRIPYWRTDNN-KNLAQRVVVYLQHGLLTSASSWISNLPNNSLGFI 74

  Fly   106 LWRAGYDVWLGNNRGNIYCRKNMWRNTTEREFWDFSWHEMGVYDLPAQVDYVLRTTGQKAMHFVG 170
            |..||||||:||:|||.:.||:::..|:.:|||.||:.||..|||||.:|:.::.|.|:.:.:||
Human    75 LADAGYDVWMGNSRGNTWSRKHLYLETSSKEFWAFSFDEMAKYDLPASIDFTVKQTRQEEIFYVG 139

  Fly   171 ISQGGTVFLVLNSMMPQYNAVFKSATLLAPVAYVSNTKSGLAKVIGPVLGTRNYVSKMLEGVEMF 235
            .|||.|:..:..|.:.:.....|....||||......||.|.::        .|..|.:  |..|
Human   140 HSQGTTIGFITFSTISKIAERIKIFFALAPVFSTKYLKSPLIRM--------TYKWKSI--VMAF 194

  Fly   236 STNK------FFKKFL-SMTCLENEKPL-----VCISRLWPAVGYDTRFLNKTLLPDLMANFPAG 288
            |.||      .||||: |..|     ||     :|::.|:...|||.:.||.:.|....::.|||
Human   195 SGNKDFLPKTSFKKFIGSKLC-----PLQIFDKICLNILFMMFGYDPKNLNMSRLDVYFSHNPAG 254

  Fly   289 GSVKQLMHYFQGYVSTRFRQYDYG-PERNWLHYQQLEPPEYALENVSTPVTVFFSENDYIVAPAD 352
            .||:.::|:.|...||..:.||:| |:.|.:||.|...|.|.:.|::....::..::|.:..|.|
Human   255 TSVQNMLHWSQLLNSTHLKAYDWGSPDLNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPED 319

  Fly   353 IWRLLTRLPNVEAVYKVPWKRWNHFDFICGLGVREYIFDNIV 394
            :..|.:.:.|  .:|......:||.|.:.||.|.:.::..|:
Human   320 VNILHSEITN--HIYYKTISYYNHIDSLFGLDVYDQVYHEII 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6753NP_650219.2 PLN02872 39..394 CDD:215470 125/365 (34%)
LIPJNP_001010939.2 Abhydro_lipase 3..66 CDD:282003 22/55 (40%)
Abhydrolase_5 47..209 CDD:289465 64/171 (37%)
Abhydrolase_1 48..347 CDD:278959 107/315 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141756
Domainoid 1 1.000 222 1.000 Domainoid score I2592
eggNOG 1 0.900 - - E2759_KOG2624
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 271 1.000 Inparanoid score I3005
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55134
OrthoDB 1 1.010 - - D408561at33208
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.