DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11600 and AT1G15060

DIOPT Version :9

Sequence 1:NP_650217.2 Gene:CG11600 / 41555 FlyBaseID:FBgn0038068 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001319006.1 Gene:AT1G15060 / 838071 AraportID:AT1G15060 Length:578 Species:Arabidopsis thaliana


Alignment Length:360 Identity:83/360 - (23%)
Similarity:138/360 - (38%) Gaps:88/360 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 IQHGLISLADSFLVTGPRSGLPFM---LADRCYDVWLSNSRGVR--YSQRHIRLKASQDAFW--- 145
            |:..|:||.:|    ...|||...   ||.|..:::....|.|.  ......||.|:.:.|.   
plant   261 IRSKLLSLIES----KQNSGLVNQVRDLAQRLVNLFDDGQRSVSPPLIDLQERLTATIEDFQKQL 321

  Fly   146 ----RFSW---HEMGMEDLPAMIDYI--LSTTNEEALHFVCHSQGCTTLLVLLSMKPEYNRMIKT 201
                ::.|   |.: .||:||.|:|:  .|...:..|..:.||.|...|..:||......|....
plant   322 DLIVKYDWDFDHYL-EEDVPAAIEYVRAQSKPKDGKLFAIGHSMGGILLYAMLSRCAFEGREPSV 385

  Fly   202 ANMMAPAVFMKHARN----KLMKMFGNIIMSMKDSSFFGPLDAIRFLLSVFCKCSKFKKLCAFMF 262
            |.:...|..:.:..:    ||:....|            |.:|    |||  .......|.|..|
plant   386 AAVATLASSVDYTTSNSALKLLIPLAN------------PAEA----LSV--PVVPLGALLAAAF 432

  Fly   263 ILASEEP--TSYMNNTAIPLILAT---HPGAIS--------TRQPKHFLQLRKSGKFRPYDFGVM 314
            .|::..|  .|::|:    ||.:|   ||..:.        |...|..:||..:  ||.   |.:
plant   433 PLSTRPPYVLSWLND----LISSTDMMHPEMLEKLVLNNFCTIPAKLLIQLTTA--FRE---GGL 488

  Fly   315 RNK--KLYNQDTPPDYPLENVRPQSPIHIYHSHGD-DLV----ARKDIHILISKLDKAVLHDVVF 372
            |::  |.|.:|.         .|::.:.:....|| ||:    |.:|...|..  :..|.:.::.
plant   489 RDRSGKFYYKDH---------LPRTSVPVLALAGDRDLICPPAAVEDTVKLFP--ENLVTYKLLG 542

  Fly   373 E----KWSHSDFLFAKLIKKVVNEPIIKVIDHFEN 403
            |    .::|.|.:..:|..:.|...|.:.:.|.::
plant   543 EPDGPHYAHYDLVGGRLAVEQVYPCITEFLSHHDS 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11600NP_650217.2 PLN02872 46..396 CDD:215470 82/351 (23%)
Abhydro_lipase 46..104 CDD:282003 5/14 (36%)
AT1G15060NP_001319006.1 Hydrolase_4 <330..545 CDD:403389 59/253 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.