DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11600 and Lipo4

DIOPT Version :9

Sequence 1:NP_650217.2 Gene:CG11600 / 41555 FlyBaseID:FBgn0038068 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001310315.1 Gene:Lipo4 / 628236 MGIID:3779637 Length:398 Species:Mus musculus


Alignment Length:368 Identity:100/368 - (27%)
Similarity:180/368 - (48%) Gaps:20/368 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IIDKYGYSVETHTVRTGDGYILDMFRIP-SSPNCKEDGFKPSVLIQHGLISLADSFLVTGPRSGL 109
            ||..:.|..|.:.|.|.|||||.:.||| ...|......|..|..||||::...:::...|.:.|
Mouse    36 IIKHWEYPSEEYEVVTDDGYILPINRIPHGKNNANSSAPKMVVFCQHGLLATPGAWVSNLPDNSL 100

  Fly   110 PFMLADRCYDVWLSNSRGVRYSQRHIRLKASQDAFWRFSWHEMGMEDLPAMIDYILSTTNEEALH 174
            .|:|||..||||:.:|||..::::|:.|......||.||:.:|...||||.|::||..|.::.::
Mouse   101 AFILADAGYDVWMGSSRGSTWAKKHVTLNTDSKEFWDFSFDQMIKYDLPATINFILDKTGQKQIY 165

  Fly   175 FVCHSQGCTTLLVLLSMKPEYNRMIKTANMMAPAVFMKHARNKLMKMFGNIIMSMKDSSFFGPLD 239
            ::.||||....:...:...:....||...::||...::|::.  :....:.:........||..:
Mouse   166 YIGHSQGTLIAIGAFATNQKLAEKIKLNILLAPIYSVQHSKG--IARLTSYLTPTTIKVLFGEKE 228

  Fly   240 AIRFLLS-----VFCKCSKFKKLCAFMFILASEEPTSYMNNTAIPLILATHPGAISTRQPKHFLQ 299
            .:..::|     ..|..:.....||.|...........:|.:.:.:.:..:....|.:...|:.|
Mouse   229 FLPTVVSSEVGAYVCDINLVTAGCAAMIGSMGGYSPEQLNMSRLDVYVKLNLAGTSVKILIHYNQ 293

  Fly   300 LRKSGKFRPYDFGVMR-NKKLYNQDTPPDYPLENVRPQSPIHIYHSHGDDLVARKDIHILISKLD 363
            :|:||..:.||:|... |.:.|||.|||.|.:|:::  .|..::....|.|...:|:.||     
Mouse   294 IRRSGILQAYDWGSSSLNMQHYNQTTPPVYNVEDMK--VPTAMFTGLKDFLSDPEDVEIL----- 351

  Fly   364 KAVLHDVVFEK----WSHSDFLFAKLIKKVVNEPIIKVIDHFE 402
            |..:|::.:.|    :||.||::....::.|:|.|:.::..::
Mouse   352 KPKIHNLTYLKTIPDFSHFDFIWGLNAREEVSEEILTILRKYD 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11600NP_650217.2 PLN02872 46..396 CDD:215470 100/360 (28%)
Abhydro_lipase 46..104 CDD:282003 21/58 (36%)
Lipo4NP_001310315.1 Abhydro_lipase 33..95 CDD:282003 21/58 (36%)
Abhydrolase_1 77..375 CDD:278959 81/306 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831788
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55134
OrthoDB 1 1.010 - - D408561at33208
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.