DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11600 and Lipo3

DIOPT Version :9

Sequence 1:NP_650217.2 Gene:CG11600 / 41555 FlyBaseID:FBgn0038068 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001013792.2 Gene:Lipo3 / 381236 MGIID:2147592 Length:399 Species:Mus musculus


Alignment Length:379 Identity:106/379 - (27%)
Similarity:182/379 - (48%) Gaps:34/379 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IIDKYGYSVETHTVRTGDGYILDMFRIP-SSPNCKEDGFKPSVLIQHGLISLADSFLVTGPRSGL 109
            ||..:.|..|.:.|.|.|||||.:.||| ...|......|..|..||||::...:::...|.:.|
Mouse    36 IIKHWDYPSEEYEVVTDDGYILPINRIPHGKNNANSSAPKMVVFCQHGLLATPGAWVSNPPVNSL 100

  Fly   110 PFMLADRCYDVWLSNSRGVRYSQRHIRLKASQDAFWRFSWHEMGMEDLPAMIDYILSTTNEEALH 174
            .|:|||..||||:.:|||..::::|:.|......||.||:.:|...||||.|::||..|.::.::
Mouse   101 AFILADAGYDVWMGSSRGSTWAKKHVALNPDSKEFWDFSFDQMIKYDLPATINFILDKTGQKQIY 165

  Fly   175 FVCHSQGCTTLLVLLSMKPEYNRMIKTANMMAPAVFMKHAR-----------NKLMKMFGNIIMS 228
            ::.||||....:...:........||...::||...::|::           ..:..:||     
Mouse   166 YIGHSQGTLLAIGAFATNQTLAEKIKLNILLAPIYSVQHSKGISHLASYLTPTTIKLLFG----- 225

  Fly   229 MKDSSFFGPLDAIRFLLSVFCKCSKFKKLC-AFMFILASEEPTSYMNNTAIPLILATHPGAISTR 292
              :..|| |......:.:..|..:.|..:| |.|..:....| ..:|.:.:.:.:..:....|.:
Mouse   226 --EKEFF-PTVVFSEVGACVCNINFFTAICAAIMGSMGGYSP-DQLNKSRLDVYVKLNLAGTSVK 286

  Fly   293 QPKHFLQLRKSGKFRPYDFG-VMRNKKLYNQDTPPDYPLENVRPQSPIHIYHSHGDDLVARKDIH 356
            ...|:.|:.:||..:.||:| ...|.:.|||.|||.|.:|:::  .|..::....|.|...:|:.
Mouse   287 VLIHYNQVGRSGILQAYDWGSPSLNMQHYNQTTPPVYNVEDMK--VPTAMFTGLKDFLSDPEDVE 349

  Fly   357 ILISKLDKAVLHDVVFEK----WSHSDFLFAKLIKKVVNEPIIKVIDHFENRQQ 406
            ||     |..:|::.:.|    :||.||:.....:|.|:|.|:.::..:|...|
Mouse   350 IL-----KPKIHNLTYLKTIPDFSHFDFILGLNARKEVSEEILTILRKYEGDVQ 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11600NP_650217.2 PLN02872 46..396 CDD:215470 104/367 (28%)
Abhydro_lipase 46..104 CDD:282003 21/58 (36%)
Lipo3NP_001013792.2 PLN02872 34..391 CDD:215470 104/370 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831786
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2624
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55134
OrthoDB 1 1.010 - - D408561at33208
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.