DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11600 and CG3635

DIOPT Version :9

Sequence 1:NP_650217.2 Gene:CG11600 / 41555 FlyBaseID:FBgn0038068 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_610138.4 Gene:CG3635 / 35447 FlyBaseID:FBgn0032981 Length:425 Species:Drosophila melanogaster


Alignment Length:414 Identity:150/414 - (36%)
Similarity:231/414 - (55%) Gaps:34/414 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLMELVIFFDWLLIVSGMPKVKFGLQNFTGRGKDYRIKVITGILIIDKYGYSVETHTVRTGDGY 65
            ::|:.||     ||::|.    |.||.:      .:::...:    |..:.|.||.|||.|.|.|
  Fly    28 VMLLTLV-----LLLLSR----KIGLVD------GHKVTATS----ISNHNYPVEEHTVITHDDY 73

  Fly    66 ILDMFRIPSSPN---CKEDGFKPSVLIQHGLISLADSFLVTGPRSGLPFMLADRCYDVWLSNSRG 127
            ||.::|||||||   ....|.:..|.:|||::|.:|.:::.||.:.|.:||||..|||||.|:||
  Fly    74 ILTIYRIPSSPNRSHLNRAGRRAVVFLQHGILSASDDWIINGPEASLAYMLADAGYDVWLGNARG 138

  Fly   128 VRYSQRHIRLKASQDAFWRFSWHEMGMEDLPAMIDYILSTTNEEALHFVCHSQGCTTLLVLLSMK 192
            ..||::|..:......||||||||:|:.||.||:||.|:.:...:||||.||||.|...||:|..
  Fly   139 NTYSRQHKHIHPDTSDFWRFSWHEIGVYDLAAMLDYALAKSQSSSLHFVAHSQGTTAFFVLMSSL 203

  Fly   193 PEYNRMIKTANMMAPAVFMKHARNKLMKMFGNIIMSMKD--SSFFGPLD--AIRFLLSVFCK--C 251
            |.||..:::.:::||..:|:. .:.::...|.|.:....  |...|.::  .|..|..:.|:  |
  Fly   204 PLYNEKLRSVHLLAPIAYMRD-HSFILSKLGGIFLGTPSFLSWVLGSMELLPITNLQKLICEHIC 267

  Fly   252 SK---FKKLCAFMFILASEEPTSYMNNTAIPLILATHPGAISTRQPKHFLQLRKSGKFRPYDFGV 313
            |.   |..||:.:........|.::|.|.:|.:.||||...|:.|..|:|||.:||.||.||.|.
  Fly   268 SSSSMFNFLCSGLLDFIGGWGTRHLNQTLLPDVCATHPAGASSSQVIHYLQLYRSGDFRQYDHGP 332

  Fly   314 MRNKKLYNQDTPPDYPLENVRPQSPIHIYHSHGDDLVARKDIHILISKLDKAVLHDVVFEKWSHS 378
            ..|:.:|.|.|||.|.::.::  |.:.:|:|..|.:.|..|:..|.|.|..|.|:.:.|..|:|.
  Fly   333 ELNEIIYQQPTPPSYNVQYIK--SCVDMYYSENDYMSAVGDVKYLASLLPCAQLYRIPFRDWNHY 395

  Fly   379 DFLFAKLIKKVVNEPIIKVIDHFE 402
            |||::..:|:|:|..||:.|..::
  Fly   396 DFLWSNNVKEVINNKIIQKIRKYD 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11600NP_650217.2 PLN02872 46..396 CDD:215470 139/361 (39%)
Abhydro_lipase 46..104 CDD:282003 26/60 (43%)
CG3635NP_610138.4 Abhydro_lipase 55..115 CDD:282003 26/59 (44%)
Abhydrolase_1 97..399 CDD:278959 114/304 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471675
Domainoid 1 1.000 150 1.000 Domainoid score I1414
eggNOG 1 0.900 - - E2759_KOG2624
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1188
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D39202at50557
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - mtm1092
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
109.900

Return to query results.
Submit another query.