DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11600 and Lipa

DIOPT Version :9

Sequence 1:NP_650217.2 Gene:CG11600 / 41555 FlyBaseID:FBgn0038068 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001104570.1 Gene:Lipa / 16889 MGIID:96789 Length:397 Species:Mus musculus


Alignment Length:405 Identity:137/405 - (33%)
Similarity:209/405 - (51%) Gaps:28/405 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLMELVIFFDWLLIVSGMPKVKFGLQNFTGRGKDYRIKVITGIL-IIDKYGYSVETHTVRTGDG 64
            |.|..||..|...:::|.:|         ||.......:|...:. ||.::||..|.|:|.||||
Mouse     1 MQLQGLVFVFTIGILLSRVP---------TGTVSAVDPEVNMNVTEIIMRWGYPGEEHSVLTGDG 56

  Fly    65 YILDMFRIP-SSPNCKEDGFKPSVLIQHGLISLADSFLVTGPRSGLPFMLADRCYDVWLSNSRGV 128
            |||.:.||| ...|....|.:|.|.:||||::.:.:::.....|.|.|:|||..:|||:.||||.
Mouse    57 YILSIHRIPRGRKNHFGKGPRPVVYLQHGLLADSSNWVTNIDNSSLGFLLADAGFDVWMGNSRGN 121

  Fly   129 RYSQRHIRLKASQDAFWRFSWHEMGMEDLPAMIDYILSTTNEEALHFVCHSQGCTTLLVLLSMKP 193
            .:|.:|..|..|||.||.||:.||...||||.|:|||:.|.:|.:::|.||||||...:..|..|
Mouse   122 TWSLKHKTLSVSQDEFWAFSFDEMAKYDLPASINYILNKTGQEQIYYVGHSQGCTIGFIAFSQMP 186

  Fly   194 EYNRMIKTANMMAPAVFMKHARNKLMKMFGN----IIMSMKDSSFFGPLDAIRFLLSV-FCKCSK 253
            |..:.||...::||.:.:..|...|::: |.    ::..|.....|.|..|:...||: .|....
Mouse   187 ELAKKIKMFLVLAPVLSLNFASGPLLQL-GRLPDPLLKDMFGQKQFLPQSAMLKWLSIHVCTHVI 250

  Fly   254 FKKLCAFMFILASEEPTSYMNNTAIPLILATH-PGAISTRQPKHFLQLRKSGKFRPYDFGVM-RN 316
            .|:|||.:|.|........:|.:.:. :..|| |...|.:...|:.|:.|..|.:.:|:|.. :|
Mouse   251 MKELCANVFFLLCGFNEKNLNMSRVD-VYTTHCPAGTSVQNMLHWGQVFKYRKLQAFDWGSSEKN 314

  Fly   317 KKLYNQDTPPDYPLENVRPQSPIHIYHSHGDDLVARKDIHILISKLDKAVLHDVVFEKWSHSDFL 381
            ...|||..||.|.::|:|  .|..::....|.|....||.||::::.|.|.|..:.| |.|.||:
Mouse   315 YFHYNQSFPPSYNIKNMR--LPTALWSGGRDWLADINDITILLTQIPKLVYHKNIPE-WDHLDFI 376

  Fly   382 FA-----KLIKKVVN 391
            :.     ||..::::
Mouse   377 WGLDAPWKLYDEIIS 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11600NP_650217.2 PLN02872 46..396 CDD:215470 127/359 (35%)
Abhydro_lipase 46..104 CDD:282003 25/58 (43%)
LipaNP_001104570.1 PLN02872 6..394 CDD:215470 135/400 (34%)
Abhydro_lipase 35..96 CDD:282003 25/60 (42%)
Abhydrolase_5 78..>192 CDD:289465 51/113 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831801
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2624
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55134
OrthoDB 1 1.010 - - D408561at33208
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.