DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11600 and LIPJ

DIOPT Version :9

Sequence 1:NP_650217.2 Gene:CG11600 / 41555 FlyBaseID:FBgn0038068 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001010939.2 Gene:LIPJ / 142910 HGNCID:21773 Length:366 Species:Homo sapiens


Alignment Length:361 Identity:114/361 - (31%)
Similarity:189/361 - (52%) Gaps:12/361 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IIDKYGYSVETHTVRTGDGYILDMFRIP--SSPNCKEDGFKPSVLIQHGLISLADSFLVTGPRSG 108
            ||..:||..|.:.:.|.|||||.::|||  .:.|.|....:..|.:||||::.|.|::...|.:.
Human     6 IISYWGYPDEEYDIVTEDGYILGLYRIPYWRTDNNKNLAQRVVVYLQHGLLTSASSWISNLPNNS 70

  Fly   109 LPFMLADRCYDVWLSNSRGVRYSQRHIRLKASQDAFWRFSWHEMGMEDLPAMIDYILSTTNEEAL 173
            |.|:|||..||||:.||||..:|::|:.|:.|...||.||:.||...||||.||:.:..|.:|.:
Human    71 LGFILADAGYDVWMGNSRGNTWSRKHLYLETSSKEFWAFSFDEMAKYDLPASIDFTVKQTRQEEI 135

  Fly   174 HFVCHSQGCTTLLVLLSMKPEYNRMIKTANMMAPAVFMKHARNKLMKM---FGNIIMSMKDSSFF 235
            .:|.||||.|...:..|...:....||....:||....|:.::.|::|   :.:|:|:...:..|
Human   136 FYVGHSQGTTIGFITFSTISKIAERIKIFFALAPVFSTKYLKSPLIRMTYKWKSIVMAFSGNKDF 200

  Fly   236 GPLDAI-RFLLSVFCKCSKFKKLCA-FMFILASEEPTSYMNNTAIPLILATHPGAISTRQPKHFL 298
            .|..:. :|:.|..|....|.|:|. .:|::...:|.: :|.:.:.:..:.:|...|.:...|:.
Human   201 LPKTSFKKFIGSKLCPLQIFDKICLNILFMMFGYDPKN-LNMSRLDVYFSHNPAGTSVQNMLHWS 264

  Fly   299 QLRKSGKFRPYDFGVM-RNKKLYNQDTPPDYPLENVRPQSPIHIYHSHGDDLVARKDIHILISKL 362
            ||..|...:.||:|.. .|...|||.|.|.|.:.|:...:.  |::...|.|...:|::||.|::
Human   265 QLLNSTHLKAYDWGSPDLNLVHYNQTTSPLYNMTNMNVATA--IWNGKSDLLADPEDVNILHSEI 327

  Fly   363 DKAVLHDVVFEKWSHSDFLFAKLIKKVVNEPIIKVI 398
            ...:.:..: ..::|.|.||...:...|...||.:|
Human   328 TNHIYYKTI-SYYNHIDSLFGLDVYDQVYHEIIDII 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11600NP_650217.2 PLN02872 46..396 CDD:215470 112/357 (31%)
Abhydro_lipase 46..104 CDD:282003 23/59 (39%)
LIPJNP_001010939.2 Abhydro_lipase 3..66 CDD:282003 23/59 (39%)
Abhydrolase_5 47..209 CDD:289465 57/161 (35%)
Abhydrolase_1 48..347 CDD:278959 93/302 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141766
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2624
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55134
OrthoDB 1 1.010 - - D408561at33208
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.