DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11600 and Lipo2

DIOPT Version :9

Sequence 1:NP_650217.2 Gene:CG11600 / 41555 FlyBaseID:FBgn0038068 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001309267.1 Gene:Lipo2 / 101055671 MGIID:3644466 Length:398 Species:Mus musculus


Alignment Length:372 Identity:104/372 - (27%)
Similarity:184/372 - (49%) Gaps:28/372 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IIDKYGYSVETHTVRTGDGYILDMFRIP-SSPNCKEDGFKPSVLIQHGLISLADSFLVTGPRSGL 109
            ||..:.|..|.:.|.|.|||||.:.||| ...|.|....|..|..||||::...:::...|.:.|
Mouse    36 IIKHWDYPSEEYEVVTDDGYILPINRIPHGKNNAKSPAPKMVVFCQHGLLATPGAWVSNPPVNSL 100

  Fly   110 PFMLADRCYDVWLSNSRGVRYSQRHIRLKASQDAFWRFSWHEMGMEDLPAMIDYILSTTNEEALH 174
            .|:|||..||||:.:|||..::::|:.|......||.||:.:|...||||.|::||..|.::.::
Mouse   101 AFILADAGYDVWMGSSRGSTWAKKHVTLNPDSKEFWDFSFDQMIKYDLPATINFILDKTGQKQIY 165

  Fly   175 FVCHSQGCTTLLVLLSMKPEYNRMIKTANMMAPAVFMKHARNKLMKMFGNIIMSMKDSSFFGPLD 239
            ::.||||....:...:...:....||...::||...::|::.  :....:.:........||..:
Mouse   166 YIGHSQGTLLAIGAFATNQKLAEKIKLNILLAPIYSVQHSKG--ISHLASYLTPTTIKLLFGEKE 228

  Fly   240 AIRFLLSV--------FCKCSKFKKLC-AFMFILASEEPTSYMNNTAIPLILATHPGAISTRQPK 295
               ||.:|        .|..:.|..:| |.|..:....|.. :|.:.:.:.:..:....|.:...
Mouse   229 ---FLPTVVFSEVGACVCNINFFTAICAAIMGSMGGYSPEE-LNKSRLDVYVKLNLAGTSVKVLI 289

  Fly   296 HFLQLRKSGKFRPYDFG-VMRNKKLYNQDTPPDYPLENVRPQSPIHIYHSHGDDLVARKDIHILI 359
            |:.|:.:||..:.||:| ...|.:.|||.|||.|.:|:::  .|..::....|.|...:|:.|| 
Mouse   290 HYNQVGRSGILQAYDWGSPSLNMRHYNQTTPPVYNVEDMK--VPTAMFTGLKDFLSDPEDVEIL- 351

  Fly   360 SKLDKAVLHDVVFEK----WSHSDFLFAKLIKKVVNEPIIKVIDHFE 402
                |..:|::.:.|    :||.||::....::.|:|.|:.::..::
Mouse   352 ----KPKIHNLTYLKTIPDFSHFDFIWGLNTREEVSEEILTILRKYD 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11600NP_650217.2 PLN02872 46..396 CDD:215470 104/364 (29%)
Abhydro_lipase 46..104 CDD:282003 22/58 (38%)
Lipo2NP_001309267.1 PLN02872 34..391 CDD:215470 104/367 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831787
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2624
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55134
OrthoDB 1 1.010 - - D408561at33208
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.