DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11598 and CG11600

DIOPT Version :9

Sequence 1:NP_001036710.1 Gene:CG11598 / 41554 FlyBaseID:FBgn0038067 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_650217.2 Gene:CG11600 / 41555 FlyBaseID:FBgn0038068 Length:406 Species:Drosophila melanogaster


Alignment Length:368 Identity:179/368 - (48%)
Similarity:249/368 - (67%) Gaps:3/368 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IDLAKGLITSEIIASHNYPVEVHTVLTRDGYLLDAFRIPGSKFCQQSGPKPAVLFQHGMSASSDV 77
            |.:..|::   ||..:.|.||.|||.|.|||:||.||||.|..|::.|.||:||.|||:.:.:|.
  Fly    38 IKVITGIL---IIDKYGYSVETHTVRTGDGYILDMFRIPSSPNCKEDGFKPSVLIQHGLISLADS 99

  Fly    78 FLLNGPQDSLAFMLADACFDVWLSNSRGTRYSRRHVSLDPSDEAFWRFSWHEIGTEDVAAFIDYI 142
            ||:.||:..|.|||||.|:|||||||||.|||:||:.|..|.:|||||||||:|.||:.|.||||
  Fly   100 FLVTGPRSGLPFMLADRCYDVWLSNSRGVRYSQRHIRLKASQDAFWRFSWHEMGMEDLPAMIDYI 164

  Fly   143 LDTTKQRALHFLGHSQGCTTLVVLLSMRPEYNKLVKTAVLLAPAVFMRHTSTLSQTVFRSFIMAM 207
            |.||.:.||||:.||||||||:|||||:||||:::|||.::||||||:|.......:|.:.||:|
  Fly   165 LSTTNEEALHFVCHSQGCTTLLVLLSMKPEYNRMIKTANMMAPAVFMKHARNKLMKMFGNIIMSM 229

  Fly   208 PDKEFMYHNGVLNKLLSNVCGLFVARVFCTTFFLISNGKISKHLNTSVIPLIAATLPAGVSSRQP 272
            .|..|......:..|||..|.....:..|...|::::.:.:.::|.:.||||.||.|..:|:|||
  Fly   230 KDSSFFGPLDAIRFLLSVFCKCSKFKKLCAFMFILASEEPTSYMNNTAIPLILATHPGAISTRQP 294

  Fly   273 KHFIQLTDSGKFRPFDFGILRNLINYKSLEPPDYTLSNVRPLTPVHIFYSDDDSSTAKEDIQNFA 337
            |||:||..||||||:|||::||...|....||||.|.||||.:|:||::|..|...|::||....
  Fly   295 KHFLQLRKSGKFRPYDFGVMRNKKLYNQDTPPDYPLENVRPQSPIHIYHSHGDDLVARKDIHILI 359

  Fly   338 ARVPEVVMHRISTPGWHHTDFVHSMTVADVINKPVIEIFRSFE 380
            :::.:.|:|.:....|.|:||:.:..:..|:|:|:|::...||
  Fly   360 SKLDKAVLHDVVFEKWSHSDFLFAKLIKKVVNEPIIKVIDHFE 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11598NP_001036710.1 Abhydro_lipase 21..82 CDD:282003 31/60 (52%)
PLN02872 22..384 CDD:215470 177/359 (49%)
CG11600NP_650217.2 PLN02872 46..396 CDD:215470 174/349 (50%)
Abhydro_lipase 46..104 CDD:282003 31/57 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471642
Domainoid 1 1.000 150 1.000 Domainoid score I1414
eggNOG 1 0.900 - - E2759_KOG2624
Homologene 1 1.000 - - H112935
Inparanoid 1 1.050 170 1.000 Inparanoid score I1188
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D40422at6656
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - mtm1092
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
1110.900

Return to query results.
Submit another query.