DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11598 and Lipo3

DIOPT Version :9

Sequence 1:NP_001036710.1 Gene:CG11598 / 41554 FlyBaseID:FBgn0038067 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001013792.2 Gene:Lipo3 / 381236 MGIID:2147592 Length:399 Species:Mus musculus


Alignment Length:389 Identity:112/389 - (28%)
Similarity:196/389 - (50%) Gaps:29/389 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FCLYIDLAKG--------LITSEIIASHNYPVEVHTVLTRDGYLLDAFRIP-GSKFCQQSGPKPA 64
            |||:     |        :..||||...:||.|.:.|:|.|||:|...||| |......|.||..
Mouse    18 FCLF-----GPKKNPEAHMNVSEIIKHWDYPSEEYEVVTDDGYILPINRIPHGKNNANSSAPKMV 77

  Fly    65 VLFQHGMSASSDVFLLNGPQDSLAFMLADACFDVWLSNSRGTRYSRRHVSLDPSDEAFWRFSWHE 129
            |..|||:.|:...::.|.|.:||||:||||.:|||:.:|||:.::::||:|:|..:.||.||:.:
Mouse    78 VFCQHGLLATPGAWVSNPPVNSLAFILADAGYDVWMGSSRGSTWAKKHVALNPDSKEFWDFSFDQ 142

  Fly   130 IGTEDVAAFIDYILDTTKQRALHFLGHSQGCTTLVVLLSMRPEYNKLVKTAVLLAPAVFMRHT-- 192
            :...|:.|.|::|||.|.|:.::::|||||....:...:......:.:|..:||||...::|:  
Mouse   143 MIKYDLPATINFILDKTGQKQIYYIGHSQGTLLAIGAFATNQTLAEKIKLNILLAPIYSVQHSKG 207

  Fly   193 -----STLSQTVFRSFIMAMPDKEFMYHNGVLNKLLSNVCGLFVARVFCTTFFLISNGKISKHLN 252
                 |.|:.|..:   :...:||| :...|.:::.:.||.:......|........|.....||
Mouse   208 ISHLASYLTPTTIK---LLFGEKEF-FPTVVFSEVGACVCNINFFTAICAAIMGSMGGYSPDQLN 268

  Fly   253 TSVIPLIAATLPAGVSSRQPKHFIQLTDSGKFRPFDFGI-LRNLINYKSLEPPDYTLSNVRPLTP 316
            .|.:.:......||.|.:...|:.|:..||..:.:|:|. ..|:.:|....||.|.:.:::  .|
Mouse   269 KSRLDVYVKLNLAGTSVKVLIHYNQVGRSGILQAYDWGSPSLNMQHYNQTTPPVYNVEDMK--VP 331

  Fly   317 VHIFYSDDDSSTAKEDIQNFAARVPEVVMHRISTPGWHHTDFVHSMTVADVINKPVIEIFRSFE 380
            ..:|....|..:..||::....::..:...: :.|.:.|.||:..:.....:::.::.|.|.:|
Mouse   332 TAMFTGLKDFLSDPEDVEILKPKIHNLTYLK-TIPDFSHFDFILGLNARKEVSEEILTILRKYE 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11598NP_001036710.1 Abhydro_lipase 21..82 CDD:282003 25/61 (41%)
PLN02872 22..384 CDD:215470 108/368 (29%)
Lipo3NP_001013792.2 PLN02872 34..391 CDD:215470 106/363 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831781
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2624
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55134
OrthoDB 1 1.010 - - D408561at33208
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.