DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11598 and CG17097

DIOPT Version :9

Sequence 1:NP_001036710.1 Gene:CG11598 / 41554 FlyBaseID:FBgn0038067 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_609429.1 Gene:CG17097 / 34461 FlyBaseID:FBgn0265264 Length:1087 Species:Drosophila melanogaster


Alignment Length:368 Identity:118/368 - (32%)
Similarity:182/368 - (49%) Gaps:26/368 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LITSEIIASHNYPVEVHTVLTRDGYLLDAFRIPGSKFCQQSGPKPAVLFQHGMSASSDVFLLNGP 83
            |.|.::|..:.||.|.:.|.:.|||.|...|||      :.|.:| ||..||:.|||..::..||
  Fly   724 LTTVDLIEKYGYPSETNYVTSEDGYRLCLHRIP------RPGAEP-VLLVHGLMASSASWVELGP 781

  Fly    84 QDSLAFMLADACFDVWLSNSRGTRYSRRHVSLDPSDEAFWRFSWHEIGTEDVAAFIDYILDTTKQ 148
            :|.||::|....:|||:.|:||..|||.:::.......:|.||:||||..||.|.||:||..|.:
  Fly   782 KDGLAYILYRKGYDVWMLNTRGNIYSRENLNRRLKPNKYWDFSFHEIGKFDVPAAIDHILIHTHK 846

  Fly   149 RALHFLGHSQGCTTLVVLLSMRPEYNKLVKTAVLLAPAVFMRHTSTLSQTVFRSFIMAMPDKEFM 213
            ..:.::|||||.|...|:.|.||.|...|.....|:|.|:::.    :::....|:.....|..|
  Fly   847 PKIQYIGHSQGSTVFFVMCSERPNYAHKVNLMQALSPTVYLQE----NRSPVLKFLGMFKGKYSM 907

  Fly   214 -------YHNGVLNKLL----SNVC-GLFVARVFCTTFFLISNGKISKHLNTSVIPLIAATLPAG 266
                   |......||:    .::| |..:....|..|..:..|...|..||::.|::||....|
  Fly   908 LLNLLGGYEISAKTKLIQQFRQHICSGSELGSSICAIFDFVLCGFDWKSFNTTLTPIVAAHASQG 972

  Fly   267 VSSRQPKHFIQLTDSGKFRPFDFGILRNLINYKSLEPPDYTLSNVRPLTPVHIFYSDDDSSTAKE 331
            .|::|..|:.||.....|:.||.|.:.|.:.|:|.|||.|.||.......:|  :.:.|...:..
  Fly   973 ASAKQIYHYAQLQGDLNFQRFDHGAVLNRVRYESSEPPAYNLSQTTSKVVLH--HGEGDWLGSTS 1035

  Fly   332 DIQNFAARVPEVVMHR-ISTPGWHHTDFVHSMTVADVINKPVI 373
            |:.....|:|.:|..| ::..|:.|.||..|..|..::...|:
  Fly  1036 DVIRLQERLPNLVESRKVNFEGFSHFDFTLSKDVRPLLYSHVL 1078

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11598NP_001036710.1 Abhydro_lipase 21..82 CDD:282003 22/60 (37%)
PLN02872 22..384 CDD:215470 116/365 (32%)
CG17097NP_609429.1 Abhydro_lipase 726..780 CDD:282003 22/60 (37%)
MhpC 746..1061 CDD:223669 105/327 (32%)
Abhydrolase_5 762..>899 CDD:289465 54/141 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439541
Domainoid 1 1.000 150 1.000 Domainoid score I1414
eggNOG 1 0.900 - - E2759_KOG2624
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D40422at6656
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - otm46497
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.