DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11598 and abhd-11.1

DIOPT Version :9

Sequence 1:NP_001036710.1 Gene:CG11598 / 41554 FlyBaseID:FBgn0038067 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_492942.1 Gene:abhd-11.1 / 185192 WormBaseID:WBGene00009316 Length:297 Species:Caenorhabditis elegans


Alignment Length:127 Identity:27/127 - (21%)
Similarity:53/127 - (41%) Gaps:15/127 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 HEIGTEDVAAFIDYILDTTKQRALHFLGHSQGCTTLVVLLSMRPEYNKLVKTAVL--LAPAVFMR 190
            :|...:|:..|||::...|.:..::..|||.| ...|..|:..|||:..:|:.::  ::|..:  
 Worm    85 YEEMADDLVGFIDWVRKITGEDKVNLHGHSMG-GKAVTQLATTPEYSSRIKSLIVEDMSPLGY-- 146

  Fly   191 HTSTLSQTVFRSFIMAMPDKEFMYHNGVLNKLLSNVCGLFVARVFCTTFFLISNGKISKHLN 252
               .|.:..:...|..|...:       :||..|.|......:|.....:....|.:.:.:|
 Worm   147 ---PLKRAEYLECIKQMIATD-------MNKSRSEVMAELGEKVSKVLLYQFVRGNLGEDVN 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11598NP_001036710.1 Abhydro_lipase 21..82 CDD:282003
PLN02872 22..384 CDD:215470 27/127 (21%)
abhd-11.1NP_492942.1 PRK10673 36..287 CDD:182637 27/127 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.