DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx3 and SNX4

DIOPT Version :10

Sequence 1:NP_650214.1 Gene:Snx3 / 41551 FlyBaseID:FBgn0038065 Length:167 Species:Drosophila melanogaster
Sequence 2:XP_016862903.1 Gene:SNX4 / 8723 HGNCID:11175 Length:482 Species:Homo sapiens


Alignment Length:112 Identity:41/112 - (36%)
Similarity:57/112 - (50%) Gaps:12/112 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KKRYTDY--EVRMRTNLPVFKVKESSVRRRYSDFEWLRNE-LERDSKIVVPPLPGK----AWKRQ 105
            ::.||.|  |.|...:.....|...|:.||||:||.||:. |.....|||||||.|    .|.: 
Human    77 QETYTAYLIETRSVEHTDGQSVLTDSLWRRYSEFELLRSYLLVYYPHIVVPPLPEKRAEFVWHK- 140

  Fly   106 MPFRGDEGIFDESFIEERRKGLEAFINKIAGHPLAQNERCLHMFLQE 152
              ...|.  .|..|:|.||.|||.|:.:||.||:...::..::||.:
Human   141 --LSADN--MDPDFVERRRIGLENFLLRIASHPILCRDKIFYLFLTQ 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx3NP_650214.1 PX_SNX3_like 32..155 CDD:132804 41/112 (37%)
SNX4XP_016862903.1 PX_SNX4 58..184 CDD:132774 41/112 (37%)
BAR_SNX4 205..480 CDD:153306
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.