DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx3 and SNX1

DIOPT Version :10

Sequence 1:NP_650214.1 Gene:Snx3 / 41551 FlyBaseID:FBgn0038065 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001229862.1 Gene:SNX1 / 6642 HGNCID:11172 Length:557 Species:Homo sapiens


Alignment Length:129 Identity:39/129 - (30%)
Similarity:69/129 - (53%) Gaps:5/129 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LEIDVVNPLTTMAAGKKRYTDYEVRMRTNLPVFKVKESSVRRRYSDFEWLRNEL-ERDSK--IVV 94
            |.:.:.:| ..:..|...|..|:|..:|:||:|:.|:.:|:||:|||..|..:| |:.|:  .:|
Human   145 LTVGITDP-EKIGDGMNAYVAYKVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIV 208

  Fly    95 PPLPGKAWKRQMPFR-GDEGIFDESFIEERRKGLEAFINKIAGHPLAQNERCLHMFLQENVIDK 157
            ||.|.|:.......: |.|......|:|:||..||.::.:|..||....:..:..||::..:.:
Human   209 PPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDVREFLEKEELPR 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx3NP_650214.1 PX_SNX3_like 32..155 CDD:132804 39/125 (31%)
SNX1NP_001229862.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..84
Sorting_nexin 11..90 CDD:461016
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..142
PX_SNX1 145..268 CDD:132814 39/123 (32%)
Membrane-binding amphipathic helix. /evidence=ECO:0000303|PubMed:19816406 281..298
BAR 286..506 CDD:472257
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.