DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx3 and snx-1

DIOPT Version :10

Sequence 1:NP_650214.1 Gene:Snx3 / 41551 FlyBaseID:FBgn0038065 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_508216.1 Gene:snx-1 / 180468 WormBaseID:WBGene00004927 Length:472 Species:Caenorhabditis elegans


Alignment Length:121 Identity:31/121 - (25%)
Similarity:48/121 - (39%) Gaps:24/121 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VVNPLTTMAAGKKRYT--DYEVRMRTNLPVFKVKESSVRRRYSDFEWLRNELERD---SKIVVPP 96
            :|..|.|..:|...||  .||                ..||:|||..|..::...   ..||:|.
 Worm   108 IVYKLETEVSGVVGYTKQHYE----------------TWRRFSDFLGLHGKIVEKYLAKGIVIPQ 156

  Fly    97 LPGKAWK--RQMPFRGDEGIFDESFIEERRKGLEAFINKIAGHPLAQNERCLHMFL 150
            .|.|:..  .:.....|..:..|..|:..|: ||.:|.::..||..:|:..:..||
 Worm   157 PPEKSISALTKTKTNSDPAMSREVGIQRARQ-LERYICRLIQHPRMRNDCDVRDFL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx3NP_650214.1 PX_SNX3_like 32..155 CDD:132804 31/121 (26%)
snx-1NP_508216.1 PX_domain 91..214 CDD:470617 31/121 (26%)
BAR_SNX1_2 243..468 CDD:153307
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.