DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha55 and Vha68-1

DIOPT Version :10

Sequence 1:NP_476908.1 Gene:Vha55 / 41550 FlyBaseID:FBgn0005671 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_523560.2 Gene:Vha68-1 / 45668 FlyBaseID:FBgn0265262 Length:614 Species:Drosophila melanogaster


Alignment Length:44 Identity:12/44 - (27%)
Similarity:19/44 - (43%) Gaps:17/44 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EAYDMFM-----HGYNSYMNYAFPAD-----------ELMPLSC 59
            ::|.|.:     |.|..:: .|.|.|           :|:||||
  Fly   142 DSYQMQLKCCGVHNYTDWL-MAMPPDDITEDDKDLIAQLVPLSC 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha55NP_476908.1 V-ATPase_V1_B 25..488 CDD:273410 12/44 (27%)
Vha68-1NP_523560.2 V-ATPase_V1_A 15..606 CDD:273411 12/44 (27%)

Return to query results.
Submit another query.