DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and S1PR2

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_004221.3 Gene:S1PR2 / 9294 HGNCID:3169 Length:353 Species:Homo sapiens


Alignment Length:401 Identity:98/401 - (24%)
Similarity:156/401 - (38%) Gaps:115/401 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 VFKAFVMLLIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIM--VAIMAMTFNFSVQVT 216
            |..||:::| ..|.:..||||:|:|.|..|.......|:.:||.:|::  ||.:|.|. .|..||
Human    35 VASAFIVIL-CCAIVVENLLVLIAVARNSKFHSAMYLFLGNLAASDLLAGVAFVANTL-LSGSVT 97

  Fly   217 GR-----W---NFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIM 273
            .|     |   ..|.|:.          .:||:..|..|:::|:.||.|...|....:.|:: ::
Human    98 LRLTPVQWFAREGSAFIT----------LSASVFSLLAIAIERHVAIAKVKLYGSDKSCRML-LL 151

  Fly   274 LLNTWISPALLSFLPIFIGWYTTPQHQQFVIQNPTQCSFVVNKYYAVISSSISFWIPCTIMIFTY 338
            :..:|:...:|..||| :||.        .:.:...||.|:..|       ...::.|.:.||:.
Human   152 IGASWLISLVLGGLPI-LGWN--------CLGHLEACSTVLPLY-------AKHYVLCVVTIFSI 200

  Fly   339 LAIFREANRQEKQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKM 403
            :.:...|.......::|..:|.:                .:.:||.|                  
Human   201 ILLAIVALYVRIYCVVRSSHADM----------------AAPQTLAL------------------ 231

  Fly   404 KREHKAARTLGIIMGTFILCWLPFFLWYTLSMTCEECQVPDIVVSILFWIGYF------NSTLNP 462
                  .:|:.|::|.||:||||.|....|...|.....|     ||:...||      ||.|||
Human   232 ------LKTVTIVLGVFIVCWLPAFSILLLDYACPVHSCP-----ILYKAHYFFAVSTLNSLLNP 285

  Fly   463 LIYAYFNRDFREAFRNTLLCLFCNWWK--------------DRH-LPLDIDIRRSSLRYDQRAKS 512
            :||.:.:||.|......|.|     |:              ..| |||     |||...::....
Human   286 VIYTWRSRDLRREVLRPLQC-----WRPGVGVQGRRRGGTPGHHLLPL-----RSSSSLERGMHM 340

  Fly   513 VYSESYLNSTT 523
            ..|.::|...|
Human   341 PTSPTFLEGNT 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 48/187 (26%)
7tm_1 170..465 CDD:278431 75/310 (24%)
S1PR2NP_004221.3 7tmA_S1PR2_Edg5 34..299 CDD:320469 85/337 (25%)
TM helix 1 35..61 CDD:320469 11/26 (42%)
TM helix 2 68..93 CDD:320469 8/25 (32%)
TM helix 3 105..135 CDD:320469 9/39 (23%)
TM helix 4 146..166 CDD:320469 3/20 (15%)
TM helix 5 186..215 CDD:320469 5/35 (14%)
TM helix 6 226..256 CDD:320469 13/53 (25%)
TM helix 7 267..292 CDD:320469 10/24 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.