DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and TAAR2

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_001028252.1 Gene:TAAR2 / 9287 HGNCID:4514 Length:351 Species:Homo sapiens


Alignment Length:334 Identity:96/334 - (28%)
Similarity:150/334 - (44%) Gaps:55/334 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 IIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWNFSPFLCDL 228
            |...|.|||.:|||:...::|...||:.::|:|:.|.::....|.::....|...|.|....|.:
Human    54 IFITIFGNLAMIISISYFKQLHTPTNFLILSMAITDFLLGFTIMPYSMIRSVENCWYFGLTFCKI 118

  Fly   229 WNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFIGW 293
            :.|.|:..|..||.|||.:::||:|||..||.|...:|..|:..:||..|..|...:|..:|...
Human   119 YYSFDLMLSITSIFHLCSVAIDRFYAICYPLLYSTKITIPVIKRLLLLCWSVPGAFAFGVVFSEA 183

  Fly   294 YTTP-QHQQFVIQNPTQCSFVVNKYYAVISSSISFWIPCTIMIFTYLAIFREANRQEKQLMMRHG 357
            |... :....::...:.|..:.||.:........|:.|.::|:..|..||        .:..:|.
Human   184 YADGIEGYDILVACSSSCPVMFNKLWGTTLFMAGFFTPGSMMVGIYGKIF--------AVSRKHA 240

  Fly   358 NAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKREHKAARTLGIIMGTFIL 422
            :|:...|                        |.::.        ::|::.|||:||||::|.|:|
Human   241 HAINNLR------------------------ENQNN--------QVKKDKKAAKTLGIVIGVFLL 273

  Fly   423 CWLPFFLWYTLSMTCEECQVPDIVVSILFWIGYFNSTLNPLIYAYFNRDFREA------------ 475
            ||.|.|....|.... ....|.::...|.|.||||||.|||||.:|...||.|            
Human   274 CWFPCFFTILLDPFL-NFSTPVVLFDALTWFGYFNSTCNPLIYGFFYPWFRRALKYILLGKIFSS 337

  Fly   476 -FRNTLLCL 483
             |.||:||:
Human   338 CFHNTILCM 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 51/178 (29%)
7tm_1 170..465 CDD:278431 83/295 (28%)
TAAR2NP_001028252.1 7tm_4 53..>180 CDD:304433 42/125 (34%)
7tm_1 60..315 CDD:278431 83/295 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.