DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and TAAR8

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_444508.1 Gene:TAAR8 / 83551 HGNCID:14964 Length:342 Species:Homo sapiens


Alignment Length:332 Identity:101/332 - (30%)
Similarity:153/332 - (46%) Gaps:47/332 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 IVWVFKAFVMLLIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQV 215
            |::...:|..||    |:.|||||:.||:..::|...||:.:.|||.||.:|.:..|.|:....|
Human    33 ILYTAFSFGSLL----AVFGNLLVMTSVLHFKQLHSPTNFLIASLACADFLVGVTVMLFSMVRTV 93

  Fly   216 TGRWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWIS 280
            ...|.|....|.|.:..||.|..:|:||||.|.:|||..:..||.|....|..|.||.:..:||.
Human    94 ESCWYFGAKFCTLHSCCDVAFCYSSVLHLCFICIDRYIVVTDPLVYATKFTVSVSGICISVSWIL 158

  Fly   281 PALLSFLPIFIGWYTTPQHQQFVIQNPT-QCSFVVNKYYAVISSSISFWIPCTIMIFTYLAIFRE 344
            |...|....:.|.......:.....|.. .|..:|::.:.:| ..:.|:||..:||..|..||..
Human   159 PLTYSGAVFYTGVNDDGLEELVSALNCVGGCQIIVSQGWVLI-DFLLFFIPTLVMIILYSKIFLI 222

  Fly   345 ANRQEKQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKM-KREHK 408
            |.:|..::                             ..|..:||.    :.:.:.|:: |||.|
Human   223 AKQQAIKI-----------------------------ETTSSKVES----SSESYKIRVAKRERK 254

  Fly   409 AARTLGIIMGTFILCWLPFFLWYTLSMTCEECQ---VPDIVVSILFWIGYFNSTLNPLIYAYFNR 470
            ||:|||:.:..|::.|||    ||:.:..:...   .|..:..|..|..|:||.:||||||.|..
Human   255 AAKTLGVTVLAFVISWLP----YTVDILIDAFMGFLTPAYIYEICCWSAYYNSAMNPLIYALFYP 315

  Fly   471 DFREAFR 477
            .||:|.:
Human   316 WFRKAIK 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 58/178 (33%)
7tm_1 170..465 CDD:278431 89/299 (30%)
TAAR8NP_444508.1 7tm_1 48..310 CDD:278431 89/299 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.