DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and taar14e

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_001076383.1 Gene:taar14e / 795656 ZFINID:ZDB-GENE-041210-317 Length:328 Species:Danio rerio


Alignment Length:346 Identity:90/346 - (26%)
Similarity:160/346 - (46%) Gaps:53/346 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 IVWVFKAFVMLLIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQV 215
            |::|..|.|.||    .:||||||||||...::|:...|..::|||.:|::|.:..:..:.|..:
Zfish    29 ILYVAAAAVALL----TVCGNLLVIISVSHFKQLQTPANILILSLAASDLLVGVFVIPLHLSWVI 89

  Fly   216 TGRWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWIS 280
            ...|.....:|.:...::...::.|:..:..|:|||:.|:..|..|...::..|..|..|..|:.
Zfish    90 ESCWTSGSVMCAVLKVVNFQATSVSVHTVALIAVDRFLALGFPFFYSEKISLTVNCIATLVNWLF 154

  Fly   281 PALLSFLPIFI-GWYTTPQHQQFVIQNPTQCSFVVNKYYAVISSSISFWIPCTIMIFTYLAIFRE 344
            ..|.:|..::| |.:|.       :..|..|..:::...:::...|.|.:||.::|..|..:|  
Zfish   155 SLLYNFTLLYINGNFTD-------VVCPGVCIAIIDGISSIVDLLIVFLMPCILIIILYTHVF-- 210

  Fly   345 ANRQEKQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKREHKA 409
                  .:..:|..|:                    :.|.:|     ::....|:.|..|.|.||
Zfish   211 ------VIAKKHATAI--------------------RALQVH-----NSTESSKNKISDKSERKA 244

  Fly   410 ARTLGIIMGTFILCWLPFFLWYTLSMTCEE--CQVPDIVVSILFWIGYFNSTLNPLIYAYFNRDF 472
            |..|||::..|:||.||:::...:.....|  ..:.|:.|.:.|    .|||:||:|||.|...|
Zfish   245 AMLLGILVFVFLLCLLPYYITSLVIPYISENLFHIRDVTVMMFF----LNSTINPIIYALFYPWF 305

  Fly   473 REAFRNTLLCLFCNWWKDRHL 493
            :::.:  |:..|..:.||..|
Zfish   306 QKSLK--LIFTFKVFNKDSSL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 45/178 (25%)
7tm_1 170..465 CDD:278431 73/297 (25%)
taar14eNP_001076383.1 7tm_1 44..298 CDD:278431 73/297 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.