DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and taar12f

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_001076376.1 Gene:taar12f / 794923 ZFINID:ZDB-GENE-041014-98 Length:337 Species:Danio rerio


Alignment Length:339 Identity:107/339 - (31%)
Similarity:166/339 - (48%) Gaps:54/339 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 VWVFKAFVMLLIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVT 216
            ::||    :||:|:..:.||||:|||:...:.|:..|:..|.|||..|.::..:.|.::....|.
Zfish    36 LYVF----LLLMILTTVFGNLLIIISISHFKHLQSPTHLIVRSLAACDCLLGSLVMPYSMVRSVE 96

  Fly   217 GRWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISP 281
            |.|.....:|.:.:|||:.|..:|:|||..||||||:||..||:|.:.:|...|.:.::..|:..
Zfish    97 GCWYLGDVVCKVHSSLDMTFCISSLLHLGLISVDRYWAICDPLRYRLRVTNTTVTVFIVFIWLFS 161

  Fly   282 ALLSFLPIFIGWYTTPQHQQFVIQ-----NPTQCSFVVNKYYAVISSSISFWIPCTIMIFTYLAI 341
            .:.||..:|.| ..|...:.|::|     |   |....||.:.:|...::|::|.|||...|:.|
Zfish   162 FVYSFYVVFSG-VNTVGLETFIMQVYCVGN---CVLYFNKQWGLICPILTFFLPGTIMSSLYMKI 222

  Fly   342 FREANRQEKQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKRE 406
            |..|.:..|.:                  .|.::|...|::                   ..:||
Zfish   223 FHVARKHAKVM------------------SERVTGGLKSQS-------------------SAQRE 250

  Fly   407 HKAARTLGIIMGTFILCWLPFFLWYTLSMTCEECQVPDIVVSILFWIGYFNSTLNPLIYAYFNRD 471
            .|||:.|.|:||.|:.||||||....|..........||..::: |..|.|||.|||||..|...
Zfish   251 RKAAKILAIVMGVFLFCWLPFFTVNALDPFFNFFTPADIFDAVI-WFAYLNSTCNPLIYGLFYPC 314

  Fly   472 FREAFR---NTLLC 482
            |::||:   :|.||
Zfish   315 FQKAFKILISTYLC 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 60/182 (33%)
7tm_1 170..465 CDD:278431 93/299 (31%)
taar12fNP_001076376.1 7tm_4 48..320 CDD:304433 98/313 (31%)
7tm_1 50..308 CDD:278431 93/299 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.