DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and taar10c

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_001076369.1 Gene:taar10c / 794440 ZFINID:ZDB-GENE-041014-57 Length:336 Species:Danio rerio


Alignment Length:341 Identity:110/341 - (32%)
Similarity:162/341 - (47%) Gaps:82/341 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 VMLLIIIAA-----ICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGR 218
            ::..|:::|     |.|||||||:|:..|:|...|||.::|||:||::|..:.|..:....:...
Zfish    38 ILFYILLSASSIITIIGNLLVIITVVHFRQLHTPTNYLILSLAVADLLVGGVVMPPSMLRSIETC 102

  Fly   219 WNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPAL 283
            |......|.:.:||||...|||||:||.||:||||||..|.:|...||.....:|::..|...|:
Zfish   103 WYLGDLFCKIHSSLDVTLCTASILNLCIISLDRYYAICHPFQYHSKMTSLATLVMIIICWTVSAV 167

  Fly   284 LSFLPIF-----IGWYTTPQHQQFVIQN---PTQCSFVVNKYYAVISSSISFWIPCTIMIFTYLA 340
            |.|..||     :|      .:.|..:|   ...|:...:|..|::.|.|.|:||..:::..||.
Zfish   168 LGFGMIFMELNILG------VEDFYYENIKCDGGCTLFQSKTIAIVYSLICFYIPALVILCVYLK 226

  Fly   341 IFREANRQEKQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKR 405
            |..||.||.:                                 .:..|..|           :|:
Zfish   227 ILHEAQRQVQ---------------------------------AIQSVNSE-----------LKK 247

  Fly   406 EHKAARTLGIIMGTFILCWLPFFLWYTLSMTCEEC---------QVPDIVVSILFWIGYFNSTLN 461
            |.||.:||.||:|.|:..|:||||          |         .||.::..:.:||||:|||.|
Zfish   248 EGKANKTLAIIIGVFLTLWVPFFL----------CNLIDPFIGYSVPPLLFDLFYWIGYYNSTCN 302

  Fly   462 PLIYAYFNRDFREAFR 477
            |::||:|...||.|||
Zfish   303 PIVYAFFYSWFRHAFR 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 67/190 (35%)
7tm_1 170..465 CDD:278431 99/311 (32%)
taar10cNP_001076369.1 7tm_4 48..>165 CDD:304433 48/116 (41%)
7tm_1 54..306 CDD:278431 99/311 (32%)
7tm_4 <130..275 CDD:304433 55/204 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.