DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and Npffr2

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_076470.1 Gene:Npffr2 / 78964 RGDID:620168 Length:417 Species:Rattus norvegicus


Alignment Length:411 Identity:108/411 - (26%)
Similarity:171/411 - (41%) Gaps:109/411 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 GLNFNESGAGLSDH---HHHQQHNPDEDWLD--NIVW---------VFKAFVMLLIIIAAIC--G 170
            |..::.:.:|..||   .:..||    .|..  ||.:         |...|:....:|..:|  |
  Rat     2 GKRWDSNSSGSWDHIWSGNDTQH----PWYSDINITYMNYYLHQPHVTAVFISSYFLIFFLCMVG 62

  Fly   171 NLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWNFSPFLCDLWNSLDVY 235
            |.:|...|:|.|.:..:||:|:.:||::|::|.|..|.......:...|.|...:|.:...:...
  Rat    63 NTVVCFVVIRNRYMHTVTNFFIFNLAISDLLVGIFCMPITLLDNIIAGWPFGSSMCKISGLVQGI 127

  Fly   236 FSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFIGWYTTPQHQ 300
            ...||:..|..|:|||:..:|.|.| | .:|.:...:|::..|       .|.|.|   .||...
  Rat   128 SVAASVFTLVAIAVDRFRCVVYPFK-P-KLTVKTAFVMIVIIW-------GLAITI---MTPSAI 180

  Fly   301 QFVIQNPTQCSFVVNKYYAV-ISS----SISFW------------IPCTIMIFT-YLAIFREANR 347
            ...:|.        .|||.| :||    |..:|            |..|::..| |||       
  Rat   181 MLHVQE--------EKYYRVRLSSHNKTSTVYWCREDWPNQEMRRIYTTVLFATIYLA------- 230

  Fly   348 QEKQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLH-----EVEQEHTPTKDKHLIKMKREH 407
               .|.:    .::|:         |..|:...|| :.|     .:||.|...|.:.:|||    
  Rat   231 ---PLSL----IVIMY---------ARIGASLFKT-SAHSTGKQRLEQWHVSKKKQKVIKM---- 274

  Fly   408 KAARTLGIIMGTFILCWLPFFLWYTLSMTCE-------ECQVPDI-VVSILFWIGYFNSTLNPLI 464
              ..|:.::   |||.|||  || ||.|..:       :.:|.:| |.....|:.:.||::||:|
  Rat   275 --LLTVALL---FILSWLP--LW-TLMMLSDYADLSPNKLRVINIYVYPFAHWLAFCNSSVNPII 331

  Fly   465 YAYFNRDFREAFRNTLLCLFC 485
            |.:||.:||..|::..  .||
  Rat   332 YGFFNENFRSGFQDAF--QFC 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 54/197 (27%)
7tm_1 170..465 CDD:278431 86/325 (26%)
Npffr2NP_076470.1 7tm_4 53..>176 CDD:304433 37/134 (28%)
7tm_1 62..332 CDD:278431 86/325 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.