DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and TRHR

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_003292.1 Gene:TRHR / 7201 HGNCID:12299 Length:398 Species:Homo sapiens


Alignment Length:410 Identity:91/410 - (22%)
Similarity:162/410 - (39%) Gaps:98/410 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 VMLLIIIA--AICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWNF 221
            ::|::||.  .|.||::|::.|||.:.:|..||.::||||:||:||.:.|...|.:..:.|.|.:
Human    29 ILLVLIICGLGIVGNIMVVLVVMRTKHMRTPTNCYLVSLAVADLMVLVAAGLPNITDSIYGSWVY 93

  Fly   222 SPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSF 286
            ....|.....|......||...:...:::||.||..|:|.....|......:::..|...:|...
Human    94 GYVGCLCITYLQYLGINASSCSITAFTIERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSLYCM 158

  Fly   287 LPIFIGWYTTPQHQQFVIQNPTQCSFVVNK-YYA---VISSSISFWIPCTIMIFTYLAIFR---- 343
            |..|:.......::..::   ..|.:.::: ||:   ::...:.:.:|..:....|..|.|    
Human   159 LWFFLLDLNISTYKDAIV---ISCGYKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFL 220

  Fly   344 -------EANRQEKQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLI 401
                   :.|.:..:....|.|..|    ::..|....:.:.||:                |.:.
Human   221 NPIPSDPKENSKTWKNDSTHQNTNL----NVNTSNRCFNSTVSSR----------------KQVT 265

  Fly   402 KMKREHKAARTLGIIMGTFILCWLPF--------FL-------WYTLSMTCEECQVPDIVVSILF 451
            ||         |.:::..|.|.|:|:        ||       |:.|  .|..|.          
Human   266 KM---------LAVVVILFALLWMPYRTLVVVNSFLSSPFQENWFLL--FCRICI---------- 309

  Fly   452 WIGYFNSTLNPLIYAYFNRDFREAFRNTLLCLFCNW-WKDRHLPLDIDIRRSSLRYDQRAKS--- 512
               |.||.:||:||...::.||.|||.     .||. .|....|.:..:   :|.|....:|   
Human   310 ---YLNSAINPVIYNLMSQKFRAAFRK-----LCNCKQKPTEKPANYSV---ALNYSVIKESDHF 363

  Fly   513 -------VYSESYLNSTTPS 525
                   ..:::||::|..|
Human   364 STELDDITVTDTYLSATKVS 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 44/183 (24%)
7tm_1 170..465 CDD:278431 69/324 (21%)
TRHRNP_003292.1 7tmA_TRH-R 26..331 CDD:320126 77/348 (22%)
TM helix 1 27..53 CDD:320126 9/23 (39%)
TM helix 2 60..85 CDD:320126 12/24 (50%)
TM helix 3 98..128 CDD:320126 7/29 (24%)
TM helix 4 141..162 CDD:320126 3/20 (15%)
TM helix 5 188..217 CDD:320126 4/28 (14%)
TM helix 6 259..289 CDD:320126 10/54 (19%)
TM helix 7 299..324 CDD:320126 11/39 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.