DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and NPFFR1

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_071429.1 Gene:NPFFR1 / 64106 HGNCID:17425 Length:430 Species:Homo sapiens


Alignment Length:440 Identity:96/440 - (21%)
Similarity:170/440 - (38%) Gaps:102/440 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 NATQPFGGSGLNFNESGA-GLSDHHHHQQHNPDEDWLDNIVWVFKAFVMLLIIIAAIC--GNLLV 174
            |::.|...:|.|...:.| .|:...::|..:|          |...|::...:|..:|  ||.||
Human    10 NSSWPLSQNGTNTEATPATNLTFSSYYQHTSP----------VAAMFIVAYALIFLLCMVGNTLV 64

  Fly   175 IISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWNFSPFLCDLWNSLDVYFSTA 239
            ...|::.|.:..:||.|:::||::|::|.|..|.......:...|.|....|.:...:.....:|
Human    65 CFIVLKNRHMHTVTNMFILNLAVSDLLVGIFCMPTTLVDNLITGWPFDNATCKMSGLVQGMSVSA 129

  Fly   240 SILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFIGWYTTPQHQQFVI 304
            |:..|..|:|:|:..||.|.:..:::.|.:|.|.::  | :.|||...|..:....|.:...|::
Human   130 SVFTLVAIAVERFRCIVHPFREKLTLRKALVTIAVI--W-ALALLIMCPSAVTLTVTREEHHFMV 191

  Fly   305 --QNPTQCSFV---------VNKYYAVISSSISFWIPCTIMIFTYLAIFREANRQEKQLMMRHGN 358
              :|.:...:.         :.:.|..:..|..:..|..:::..|..|.|:              
Human   192 DARNRSYPLYSCWEAWPEKGMRRVYTTVLFSHIYLAPLALIVVMYARIARK-------------- 242

  Fly   359 AMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKREHKAARTLGIIMGTFILC 423
              |...|...|.||..:...:|                       :|..:....|.::...|.|.
Human   243 --LCQAPGPAPGGEEAADPRAS-----------------------RRRARVVHMLVMVALFFTLS 282

  Fly   424 WLPFFLW-YTLSMTCEECQVPDIVVSILF------WIGYFNSTLNPLIYAYFNRDFREAFRNTLL 481
            |||  || ..|.:...:...|.:.:..::      |:.:|||:.||:||.|||.:||..|:....
Human   283 WLP--LWALLLLIDYGQLSAPQLHLVTVYAFPFAHWLAFFNSSANPIIYGYFNENFRRGFQAAFR 345

  Fly   482 CLFCNWWKDRHLPLDIDIRRSSLRYDQRAKSVYSESYLNSTTPS---HRR 528
            ...|                      .|....:.|:|  |..|.   |||
Human   346 ARLC----------------------PRPSGSHKEAY--SERPGGLLHRR 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 44/190 (23%)
7tm_1 170..465 CDD:278431 67/312 (21%)
NPFFR1NP_071429.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 2/9 (22%)
7tm_GPCRs 44..340 CDD:333717 77/339 (23%)
TM helix 1 46..70 CDD:320095 8/23 (35%)
TM helix 2 79..101 CDD:320095 8/21 (38%)
TM helix 3 117..139 CDD:320095 4/21 (19%)
TM helix 4 160..176 CDD:320095 6/18 (33%)
TM helix 5 214..237 CDD:320095 3/22 (14%)
TM helix 6 266..291 CDD:320095 8/26 (31%)
TM helix 7 308..333 CDD:320095 9/24 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 379..413
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.