DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and lpar6a

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_001073524.1 Gene:lpar6a / 571773 ZFINID:ZDB-GENE-061013-343 Length:357 Species:Danio rerio


Alignment Length:423 Identity:84/423 - (19%)
Similarity:155/423 - (36%) Gaps:119/423 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 DNIVWVFKAFVMLLIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSV 213
            ||..:...:.|..::.:..:..|:..:...|...|||..|..::::|.::|::. ::.:......
Zfish    23 DNFKYPLYSMVFSIVFMVGLITNVAAMYIFMCSLKLRNETTTYMMNLVVSDLLF-VLTLPLRVFY 86

  Fly   214 QVTGRWNFSPFLCDLWNSLDVYFST--ASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLN 276
            .|...|.|...||.|  |:.::::.  .|||.|.||||||:.|||.|.:.....|||...|:...
Zfish    87 FVQQNWPFGSLLCKL--SVSLFYTNMYGSILFLTCISVDRFLAIVYPFRSRGLRTKRNAKIVCAA 149

  Fly   277 TWISPALLSFLPIFIGWYTTPQHQQFVIQNPTQC--SFVVNKYYAVIS------SSISFWIP--- 330
            .|:. .|...||......:|.:.:    .|...|  :|...::.:.:|      .::.|.||   
Zfish   150 VWVL-VLSGSLPTGFMLNSTNKLE----NNSISCFENFSSKEWKSHLSKVVIFIETVGFLIPLML 209

  Fly   331 ---CTIMIFTYLAIFREANRQEKQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEH 392
               |:.|:.                       ..:.||:....|..|:                 
Zfish   210 NVVCSAMVL-----------------------QTLRRPNTVSRGGKLN----------------- 234

  Fly   393 TPTKDKHLIKMKREHKAARTLGIIMGTFI--LCWLPF---FLWYTLSMT-----CEECQVPDIVV 447
                .|.:::|           ||:..||  .|::|:   .::|:|..|     |....|...:.
Zfish   235 ----KKKILRM-----------IIVHLFIFCFCFIPYNVNLVFYSLVRTNTLKGCAAESVVRTIY 284

  Fly   448 SILFWIGYFNSTLNPLIYAYFNRDFREAFRNTLLCLFCNWWKDRHLPLDIDIRRSSLRYDQRAKS 512
            .|...|...|...:|::| ||..:                          .|:.|..|..|...|
Zfish   285 PIALCIAVSNCCFDPIVY-YFTSE--------------------------TIQNSIKRKTQTGHS 322

  Fly   513 V---YSESYLNSTTPSHRRQSQMVDNLXYRDEA 542
            :   :||:..:.|:.:.:...:.:.|..:.:|:
Zfish   323 IDVKFSEALQSETSSTLQFSLRSIKNKMFHNES 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 47/193 (24%)
7tm_1 170..465 CDD:278431 68/320 (21%)
lpar6aNP_001073524.1 7tm_4 39..>166 CDD:304433 37/130 (28%)
7tm_1 45..302 CDD:278431 68/319 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.