DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and MC5R

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_005904.1 Gene:MC5R / 4161 HGNCID:6933 Length:325 Species:Homo sapiens


Alignment Length:382 Identity:84/382 - (21%)
Similarity:153/382 - (40%) Gaps:103/382 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 LNFNESGAGLSDHHHHQQHNPDEDWLDNIVWVFKAFVMLLIIIAAICGNLLVIISVMRVRKLRVI 187
            ||.|.:...||..:...:.:|.|| :...|.||     |.:.:.::..|:|||.::::.:.|...
Human    12 LNLNATEGNLSGPNVKNKSSPCED-MGIAVEVF-----LTLGVISLLENILVIGAIVKNKNLHSP 70

  Fly   188 TNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWN------FSPFLCDLWNSLDVYFSTASILHLCC 246
            ..:||.|||:||::|::.:.....::.:....:      |...:.::::|:......||:..|..
Human    71 MYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDSMICISVVASMCSLLA 135

  Fly   247 ISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFIGWYTTPQHQQFVIQNPTQCS 311
            |:||||..|...|:|...||.|..|.::...|      :|.                    |.|.
Human   136 IAVDRYVTIFYALRYHHIMTARRSGAIIAGIW------AFC--------------------TGCG 174

  Fly   312 FVVNKY----YAVISSSISFWIPCTIMIFTYLAIFREANRQEKQLMMRHGNAMLMHRPSMQPSGE 372
            .|...|    |.::.....|:....:::..|:.:|..|....|::....|.:....|.|||    
Human   175 IVFILYSESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSMQ---- 235

  Fly   373 ALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKREHKAARTLGIIMGTFILCWLPFFLWYTLSMTC 437
                                                .|.|:.:::|.|.:||.||||..||.::|
Human   236 ------------------------------------GAVTVTMLLGVFTVCWAPFFLHLTLMLSC 264

  Fly   438 EE---CQVPDIVVSILFWIGYF---------NSTLNPLIYAYFNRDFREAFRNTLLC 482
            .:   |.         .::.:|         ||.::|||||:.:::.|:.|:..:.|
Human   265 PQNLYCS---------RFMSHFNMYLILIMCNSVMDPLIYAFRSQEMRKTFKEIICC 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 39/187 (21%)
7tm_1 170..465 CDD:278431 66/316 (21%)
MC5RNP_005904.1 7tm_4 43..>167 CDD:304433 32/128 (25%)
7tm_1 53..295 CDD:278431 66/316 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.