DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and MC3R

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_063941.3 Gene:MC3R / 4159 HGNCID:6931 Length:323 Species:Homo sapiens


Alignment Length:358 Identity:88/358 - (24%)
Similarity:140/358 - (39%) Gaps:107/358 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 KAFVMLLIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAI------MAMTFNFSVQ 214
            |..|.|.:.|.::..|:|||::|:|...|.....:|:.|||:||::|::      :.:....|..
Human    41 KPEVFLSLGIVSLLENILVILAVVRNGNLHSPMYFFLCSLAVADMLVSVSNALETIMIAIVHSDY 105

  Fly   215 VTGRWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWI 279
            :|....|...:.::::|:......|||.:|..|:||||..|...|:|...||.|....:::..|:
Human   106 LTFEDQFIQHMDNIFDSMICISLVASICNLLAIAVDRYVTIFYALRYHSIMTVRKALTLIVAIWV 170

  Fly   280 SPALLSFLPIFIGWYTTPQHQQFVIQNPTQCSFVVNKYYAVISSSISFWIPCTIMIF-------- 336
                                          |..|....:.|.|.| ...|.|.|.:|        
Human   171 ------------------------------CCGVCGVVFIVYSES-KMVIVCLITMFFAMMLLMG 204

  Fly   337 -TYLAIFREANRQEKQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHL 400
             .|:.:|..|....|::      |.|.....:.|                    |:|:..     
Human   205 TLYVHMFLFARLHVKRI------AALPPADGVAP--------------------QQHSCM----- 238

  Fly   401 IKMKREHKAARTLGIIMGTFILCWLPFFLWYTLSMTCEE---CQVPDIVVSILFWIGYF------ 456
                   |.|.|:.|::|.||.||.||||...|.:||..   |         :.:..:|      
Human   239 -------KGAVTITILLGVFIFCWAPFFLHLVLIITCPTNPYC---------ICYTAHFNTYLVL 287

  Fly   457 ---NSTLNPLIYAYFNRDFREAFRNTLLCLFCN 486
               ||.::|||||:.:.:.|..||. :|| .||
Human   288 IMCNSVIDPLIYAFRSLELRNTFRE-ILC-GCN 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 45/192 (23%)
7tm_1 170..465 CDD:278431 74/321 (23%)
MC3RNP_063941.3 7tm_4 45..>170 CDD:304433 35/124 (28%)
7tm_1 55..299 CDD:278431 74/321 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.