DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and Taar8b

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_001010837.1 Gene:Taar8b / 382348 MGIID:2685995 Length:344 Species:Mus musculus


Alignment Length:318 Identity:106/318 - (33%)
Similarity:151/318 - (47%) Gaps:41/318 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 IAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWNFSPFLCDLW 229
            :.|:||||||:|||:..::|....|:.:.|||.||.:|.|..|.|:....:...|.|....|.|.
Mouse    43 VLAVCGNLLVVISVLHFKQLHSPANFLIASLASADFLVGISVMPFSMVRSIESCWYFGDAFCSLH 107

  Fly   230 NSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFIGWY 294
            :..||.|..:|.||||.||||||.|:..||.||...|..|.||.:..:||.|.:.|....:.| .
Mouse   108 SCCDVAFCYSSALHLCFISVDRYIAVTDPLVYPTKFTVSVSGICISISWILPLVYSSAVFYTG-I 171

  Fly   295 TTPQHQQFV--IQNPTQCSFVVNKYYAVISSSISFWIPCTIMIFTYLAIFREANRQEKQLMMRHG 357
            :....:..|  :.....|..|||:.:.:| ..:.|:||..:||..|..||..|.:|         
Mouse   172 SAKGIESLVSALNCVGGCQIVVNQDWVLI-DFLLFFIPTLVMIILYSKIFLVAKQQ--------- 226

  Fly   358 NAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKREHKAARTLGIIMGTFIL 422
             |:.:........||:.|.|..::.                    .|||.|||:|||:.:..|::
Mouse   227 -AVKIETSVSDNRGESSSESHKARV--------------------AKRERKAAKTLGVTVVAFMV 270

  Fly   423 CWLPFFLWYTLSMTCEECQ---VPDIVVSILFWIGYFNSTLNPLIYAYFNRDFREAFR 477
            .|||    ||:....:...   .|..|..|..|..|:||.:||||||:|...||:|.:
Mouse   271 SWLP----YTIDSLVDAFVGFITPAYVYEICCWSAYYNSAMNPLIYAFFYPWFRKAIK 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 65/178 (37%)
7tm_1 170..465 CDD:278431 97/299 (32%)
Taar8bNP_001010837.1 7tm_4 42..327 CDD:304433 106/318 (33%)
7tm_1 48..312 CDD:278431 97/299 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.