DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and CG13579

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_001261169.1 Gene:CG13579 / 37905 FlyBaseID:FBgn0035010 Length:716 Species:Drosophila melanogaster


Alignment Length:397 Identity:82/397 - (20%)
Similarity:145/397 - (36%) Gaps:85/397 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 IVWVFKAFVMLLIIIAAICGNLLVIISVMRVRKLRVI---TNYFVVSLAMADIMVAIMAMTFNFS 212
            |....:|.::|::.:..|..|.|||..:...|....|   ..|.:.|||:.|:.:.::...|...
  Fly    35 IAETIEAVLILVLTLGVIGANCLVIFVINNRRYAAYIHQQPRYLLTSLALNDLTIGLLITPFGLM 99

  Fly   213 VQVTGRWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNT 277
            ..:...|.:....|.:...|....|..|.:.|.|::||||...:.|.:|....:|:....:|..|
  Fly   100 PALFHCWPYGEIFCQIQALLRGALSQQSAVILVCMAVDRYMCALHPRRYYQHSSKKGCVAILSLT 164

  Fly   278 W-ISPALLSFLPIFIGWYTTPQHQQFVIQNPTQCS-FVVNKYYAVISSSISFWIPCTIMIFTYLA 340
            | ||..:..||.:..|:|       |.......|. |.....|.::|:...::....::::.|.:
  Fly   165 WIISLTVFGFLVLPKGYY-------FNNTGLMACEPFYSKPSYRILSTCALYFPTTMVLMYCYGS 222

  Fly   341 IFREAN-----------------------RQEKQLMMR----------------HGNAMLMHRPS 366
            .|..:.                       ...:||.|.                ||::   |.||
  Fly   223 SFHMSRFRLNDPTMPLTAAAHHPHPHPHPTAAQQLQMHQHQQHHQQAGMHSHLYHGHS---HHPS 284

  Fly   367 MQPS----------------------GEALS-GSGSSKTLTLHEVEQEHTPTKDKHLIKMKREHK 408
             .||                      ..|:| |......:| :::.::..|.::|:.........
  Fly   285 -HPSHPNHPNHHGHPHHHGPPVMGHLSMAMSMGLAGMPNMT-NKITKKIVPIQEKNSSGSTSRSM 347

  Fly   409 AARTLGIIMGTFILCWLPFFLWYTLSMTCEECQVPDIVVSILFWIGYFNSTLNPLIYAYFNRDFR 473
            ||.:||     ||:...|:.: ..:...|...::|..:..::.|....||..||.:|...|.|||
  Fly   348 AAISLG-----FIVMVTPWTI-QEIVTACTGSKLPPFLDFLVTWTALSNSLWNPFMYWLLNSDFR 406

  Fly   474 EAFRNTL 480
            ...|..:
  Fly   407 RMSRQLM 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 42/182 (23%)
7tm_1 170..465 CDD:278431 72/361 (20%)
CG13579NP_001261169.1 7tm_4 51..>148 CDD:304433 25/96 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.