DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and AkhR

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_995639.1 Gene:AkhR / 33942 FlyBaseID:FBgn0025595 Length:455 Species:Drosophila melanogaster


Alignment Length:325 Identity:81/325 - (24%)
Similarity:141/325 - (43%) Gaps:64/325 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 LLIIIAAICGN--LLVIISVMRVR-KLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWNFS 222
            :|.:|:.| ||  :|.:::..|:| .||:  :..::.||:||:||.::.|........|.:|..:
  Fly    47 ILFVISTI-GNSTVLYLLTKRRLRGPLRI--DIMLMHLAIADLMVTLLLMPMEIVWAWTVQWLST 108

  Fly   223 PFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLS-- 285
            ..:|.|.:...|:....|...:.|||:|||:||:||||...:..:    |||...|:...:.|  
  Fly   109 DLMCRLMSFFRVFGLYLSSYVMVCISLDRYFAILKPLKRSYNRGR----IMLACAWLGSVVCSIP 169

  Fly   286 --FL------PIFIGWYTTPQHQQFVIQNPTQCSFVVNKYYAVISSSISFWIPCTIMIFTYLAIF 342
              ||      |...|::      |.||.|..:..| ..|.|...|....:..|..:.|:.|.||:
  Fly   170 QAFLFHLEEHPAVTGYF------QCVIFNSFRSDF-DEKLYQAASMCSMYAFPLIMFIYCYGAIY 227

  Fly   343 REANRQEKQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKREH 407
            .|..|:.:::                                |.:|..|.....:..::...::.
  Fly   228 LEIYRKSQRV--------------------------------LKDVIAERFRRSNDDVLSRAKKR 260

  Fly   408 KAARTLGIIMGTFILCWLPFF---LWYTLSMTCEECQVPDIVVSILFWIGYFNSTLNPLIYAYFN 469
            ....|:.|:: .||:||.|::   :||.|... ...::..::...||.....||.:|||:|..:|
  Fly   261 TLKMTITIVI-VFIICWTPYYTISMWYWLDKH-SAGKINPLLRKALFIFASTNSCMNPLVYGLYN 323

  Fly   470  469
              Fly   324  323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 55/190 (29%)
7tm_1 170..465 CDD:278431 76/310 (25%)
AkhRNP_995639.1 7tm_1 55..319 CDD:278431 76/310 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.